PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v3188580.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WOX
Protein Properties Length: 260aa    MW: 29673.9 Da    PI: 6.5074
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v3188580.4genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.71.3e-203392357
                     --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                     +R+++tkeq++ Le+l+++  ++p+aee+++++++l    +++ ++V++WFqN++a++++
  Lj3g3v3188580.4 33 SRWNPTKEQITLLESLYKQgIKTPTAEEIQQITARLrvhgHIEGKNVFYWFQNHKARQRQ 92
                     7*****************99**************************************97 PP

2Wus_type_Homeobox113.97.8e-373194265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       a++RW+Pt+eQi++Le+lyk+G++tP++eeiq+ita+L+ +G+ie+kNVfyWFQN+kaR+rqkq
    Lj3g3v3188580.4 31 ASSRWNPTKEQITLLESLYKQGIKTPTAEEIQQITARLRVHGHIEGKNVFYWFQNHKARQRQKQ 94
                       689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.0292893IPR001356Homeobox domain
SMARTSM003891.1E-63097IPR001356Homeobox domain
SuperFamilySSF466892.27E-123399IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-83392IPR009057Homeodomain-like
PfamPF000462.7E-183392IPR001356Homeobox domain
CDDcd000866.52E-73494No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MEESHHHHHE NNEEELEMGM GGSSGGNNIA ASSRWNPTKE QITLLESLYK QGIKTPTAEE  60
IQQITARLRV HGHIEGKNVF YWFQNHKARQ RQKQKQETIA YFNRFLHRPP QPFFSPPIYP  120
NALCGPYCMP QPNSEIGFYP QQYSKVLLPV GYRNHHVEKV VPNGMSSVYN SQLVYDVNMQ  180
QRISDHNIHF NNQETLDLFP LHPTGILEGK TTRTDKVSSL VSVSADSSTD TTSGSPDINE  240
EDGCPENQPF FDFFNSRQGS
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj3g3v3188580.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027348274.11e-122WUSCHEL-related homeobox 2
TrEMBLA0A151TMG61e-117A0A151TMG6_CAJCA; WUSCHEL-related homeobox 2
STRINGGLYMA11G14940.21e-116(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.12e-44WUSCHEL related homeobox 2