PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v3082350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 755aa    MW: 83322.5 Da    PI: 7.2456
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v3082350.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-095485851954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  Lj3g3v3082350.1 548 FEHflHPYPTDTDKHMLATQTGLSRNQVSNWFINARVR 585
                      665559******************************87 PP

2BELL111.25.9e-36404474272
             BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      r e qk kakLl ++eeV +rYkqy++q+q+v+ssF+ vagl sa+pY+slAlk +SrhFrcLk+ai++q+
  Lj3g3v3082350.1 404 RPECQKNKAKLLYMQEEVTRRYKQYHQQMQMVVSSFDSVAGLSSATPYISLALKSVSRHFRCLKNAITDQL 474
                      5689****************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-46309472IPR006563POX domain
PfamPF075262.8E-44314471IPR006563POX domain
PROSITE profilePS5007111.92526589IPR001356Homeobox domain
SMARTSM003891.1E-8529593IPR001356Homeobox domain
CDDcd000862.29E-11529590No hitNo description
SuperFamilySSF466896.42E-17531595IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-27532593IPR009057Homeodomain-like
PfamPF059203.5E-18546585IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 755 aa     Download sequence    Send to blast
MSGSRRELHV TQQTRREKLR IQNSFGINVE QVSSSSHPAV GFNNSLDLVE VRNVRNGGDN  60
NNNNNMLVDD AAAAAFYSSE MITPPPLSAT RNMLECQDQL VEPSRLMMPP QYSSLFPQYS  120
SSNLHSSPKQ DWRNSSSNPH HQVSDWMVNN YGSSSSIPNI NFLASEFNVS ATQKQLGEMH  180
YPPPSSNSSP PLYHNALQDI FKSASPINSH GSVQMASSSI MHHGIWGSGN SNNNSEHAQY  240
GNLWPLSSDC NNHPHQGLCL SLSSNSQSKP SIEEGSTSDD PQYSKPVGIA VPSSSTASFR  300
NIGPLGPFTG YATILKSSRY LKPCQQLLDE YCCQKSEKSP KWVSRENSAN SVSALGGGGG  360
SNSGSGNSSS MLYAPAAAAK ENSSCSGDGG GGKSSSSFCG SSSRPECQKN KAKLLYMQEE  420
VTRRYKQYHQ QMQMVVSSFD SVAGLSSATP YISLALKSVS RHFRCLKNAI TDQLKLTCDV  480
LGDEFSMPTT STSSKMVDNN MARLRCNLDQ SFHKNKSNMD FFEPQQHVWR PQRGLPERAV  540
AILKAWLFEH FLHPYPTDTD KHMLATQTGL SRNQVSNWFI NARVRVWKPM VEEIHMLETK  600
GTTTENHQNS SKNEGASAAD QGNNHAGVDQ HMSKFGSTTH AIVPEKQFQH LEMGSSSTGN  660
IVEKRIEEDE QWNIQLEKRS KYECEIAPAP SMDETLMGFM PYRRGGLEVG GLGPVSLTLG  720
LRHGVEGTQH QQQQLQHEEE LRRQFGGHMI HDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B2e-15535592158Homeobox protein Meis1
4xrs_A2e-15535592158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014493332.10.0PREDICTED: BEL1-like homeodomain protein 8
TrEMBLV7AFC30.0V7AFC3_PHAVU; Uncharacterized protein
STRINGGLYMA12G08270.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34813257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.13e-78BEL1-like homeodomain 8