PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v2938490.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 750aa    MW: 82061.6 Da    PI: 6.8743
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v2938490.4genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-094284651954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Lj3g3v2938490.4 428 FEHflHPYPKDSDKVMLAKQTGLTRSQVSNWFINARVR 465
                      554459******************************88 PP

2BELL117.37.2e-38291362172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      +rqelq+kk+kLls+l+eV+ rY+qy++q+ +vissFe+ +g+g+ak+Yt+lAlk+iS++FrcLkdai++qi
  Lj3g3v2938490.4 291 QRQELQMKKSKLLSMLDEVELRYRQYHNQMDMVISSFEQGTGYGAAKSYTTLALKTISKQFRCLKDAISSQI 362
                      69*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-55217360IPR006563POX domain
PfamPF075268.6E-46222359IPR006563POX domain
PROSITE profilePS5007112.082406469IPR001356Homeobox domain
SMARTSM003897.8E-10409473IPR001356Homeobox domain
CDDcd000861.70E-12409470No hitNo description
SuperFamilySSF466897.27E-17410475IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28412475IPR009057Homeodomain-like
PfamPF059205.2E-18426465IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    Send to blast
MATYFHGNTS SEIESSAEGL QTLYLMNPNY VPYSDAPNML LVNPNTSIAA AGTSANALNL  60
SNFSHAPPPS SANNHHHHQQ QQQNHLVGFT IPSSNILGST TTNTTTGNSN HLGQHGISGG  120
FQSFAATTTP AVVATNPRAH YNLWGSIINQ TMSSVTTAAE TTPSNNSAYS AAVTVADDSG  180
YNNRGNQQSG LSLSLSSQQP SFRSLSGGEI GVPVSRSAGN GVILGSKYLK AVQEVLDEAV  240
KVGKEICEGE SMEGAPKNNK EKMRANIESE TSGIGENSGS NKQGAELSMA QRQELQMKKS  300
KLLSMLDEVE LRYRQYHNQM DMVISSFEQG TGYGAAKSYT TLALKTISKQ FRCLKDAISS  360
QIKTASKTLG DQDDCLGAKV EGSRLRYVDH HLRQQRALQQ LGMIQHNAWR PQRGLPERAV  420
SVLRAWLFEH FLHPYPKDSD KVMLAKQTGL TRSQVSNWFI NARVRLWKPM VEEMYLEEIK  480
EQEQNNDNTN RSAKDQSSKE LWSASATNAT HESSSGALKL DQQINSFHSK PERLINNQNT  540
SPTEISNSDN NSLSTSPMGG GSFQSQYSGF HLAESSSEIQ IRSSPKKPRS SEMQQHFPGS  600
MNMEMKPGGE ETREANTEFD TERHNKDGYP LKTSGDENHG GGYGGAFSME DIGRFNVTDQ  660
LAPRFHGNGV SLTLGLPHND NLSLSATQHG FLPQNMHLGG RLEMETNENE FCGINNTTAP  720
PSSHSGTSYE NIDIQNRKRF AAQLLRNFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16415473563Homeobox protein Meis2
3k2a_B2e-16415473563Homeobox protein Meis2
4xrs_A2e-16415472158Homeobox protein Meis1
4xrs_B2e-16415472158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007132496.10.0hypothetical protein PHAVU_011G099100g
RefseqXP_007132497.10.0hypothetical protein PHAVU_011G099100g
TrEMBLV7AGT90.0V7AGT9_PHAVU; Uncharacterized protein
STRINGGLYMA12G10030.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-107BEL1-like homeodomain 1