PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v2579340.1
Common Namensp1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GRAS
Protein Properties Length: 542aa    MW: 59735.4 Da    PI: 6.5104
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v2579340.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS253.38.9e-781555322374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++lL  cA a++ g+ +++q+lL  l+elasp+gdp++Rlaa+ ++AL ++l++s+s+  ++ + + +s ++     ++l  f+evsP++ f +
  Lj3g3v2579340.1 155 EQLLNPCAAAIAGGNVNRVQHLLYVLHELASPTGDPNHRLAAHGLRALTHHLSSSSSSPTSSGTITFAS-TEPRFFQKSLLKFYEVSPWFSFPN 247
                      689***************************************************555544444433333.234444555555************ PP

             GRAS  96 ltaNqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg.......skeeleetgerLakfAeelgvpf 176
                       +aN  Il+ +++e     +++Hi+D+++s+G+QWp+Ll+aL+ R++gpp  +R+T+v +++ +       ++    ++  rL  +A+++++++
  Lj3g3v2579340.1 248 NIANASILQVLAEEanitsRTLHILDIGVSHGVQWPTLLDALSRRSGGPPsVVRLTVVTAENDQnmetpfsKAPPGYNYYPRLLGYAQSIKINL 341
                      ***********99966766677************************9999689******988778999998888999***************** PP

             GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh...nsesFlerflealeyysal 267
                      ++n +  ++l++l+ ++++ +p+E l+V+ +++lh+l ++   +++er+e+Lk++ +++P+ v+++e+++++   + ++F+++f++ +ey + +
  Lj3g3v2579340.1 342 QINRIENHSLQTLNAQSISASPDEILIVCAQFRLHHLNHN---SPDERSEFLKVLGNMEPRGVILSENNTECccsGCGNFAAGFTRRVEYLWRF 432
                      ****9999*****************************955...555566*******************9776534667**************** PP

             GRAS 268 fdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv 359
                      +ds+ +a  +res+er+ +E e     + ++++++ ++    +e++ekW  r++eaGF    ++e+a++  ++llrk++ +++++vee++ s+ 
  Lj3g3v2579340.1 433 LDSTsSAVKGRESDERREMEGE-----AAKALTNQREM----NEEKEKWCGRMKEAGFAGEVFGEDAVDGGRALLRKYDsNWEMKVEEKNTSVG 517
                      ****555556677777777766.....66677666655....89999********************************9999*********** PP

             GRAS 360 lgWkdrpLvsvSaWr 374
                      l Wk++p+ ++S W+
  Lj3g3v2579340.1 518 LWWKGQPVSFCSLWK 532
                      **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.32128511IPR005202Transcription factor GRAS
PfamPF035143.1E-75155532IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MTMEPNSTTS DHILDWLEGS VSFFPSFLDE PCNNSGYIQE YHLWDQYQTD ANTGSSPNAT  60
NSTTATIVAT SATSTTSLEP CGSNNNQPLS DLPKKRNATD ESSLKPPQNK NKRIKTRPMN  120
EPENGDAVRK NKKGGAKANG SNCNSGNSKE GRWAEQLLNP CAAAIAGGNV NRVQHLLYVL  180
HELASPTGDP NHRLAAHGLR ALTHHLSSSS SSPTSSGTIT FASTEPRFFQ KSLLKFYEVS  240
PWFSFPNNIA NASILQVLAE EANITSRTLH ILDIGVSHGV QWPTLLDALS RRSGGPPSVV  300
RLTVVTAEND QNMETPFSKA PPGYNYYPRL LGYAQSIKIN LQINRIENHS LQTLNAQSIS  360
ASPDEILIVC AQFRLHHLNH NSPDERSEFL KVLGNMEPRG VILSENNTEC CCSGCGNFAA  420
GFTRRVEYLW RFLDSTSSAV KGRESDERRE MEGEAAKALT NQREMNEEKE KWCGRMKEAG  480
FAGEVFGEDA VDGGRALLRK YDSNWEMKVE EKNTSVGLWW KGQPVSFCSL WKLDGNDQGG  540
TS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-3914853281473Protein SHORT-ROOT
5b3h_B7e-4014853227419Protein SHORT-ROOT
5b3h_E7e-4014853227419Protein SHORT-ROOT
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in epidermal and cortical root cells. {ECO:0000269|PubMed:15961669}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj3g3v2579340.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0128190.0EF012819.1 Lotus japonicus nodulation signaling pathway 1 protein (nsp1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012574062.10.0nodulation-signaling pathway 1 protein
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA1DQP90.0A1DQP9_LOTJA; Nodulation signaling pathway 1 protein
STRINGAET017700.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-154GRAS family protein
Publications ? help Back to Top
  1. Heckmann AB, et al.
    Lotus japonicus nodulation requires two GRAS domain regulators, one of which is functionally conserved in a non-legume.
    Plant Physiol., 2006. 142(4): p. 1739-50
    [PMID:17071642]
  2. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  3. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]