PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v2578300.1
Common Namensp1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GRAS
Protein Properties Length: 57aa    MW: 6471.21 Da    PI: 4.4298
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v2578300.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS23.37e-081053303346
             GRAS 303 aerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks 346
                      +++re +e++ekW  r++eaGF    ++e+a++  ++llrk++s
  Lj3g3v2578300.1  10 TNQREMNEEKEKWCGRMKEAGFAGEVFGEDAVDGGRALLRKYDS 53 
                      567899999********************************984 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS509859.001157IPR005202Transcription factor GRAS
PfamPF035142.4E-51053IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 57 aa     Download sequence    Send to blast
MEGEAAKALT NQREMNEEKE KWCGRMKEAG FAGEVFGEDA VDGGRALLRK YDSNWEM
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in epidermal and cortical root cells. {ECO:0000269|PubMed:15961669}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj3g3v2578300.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0128193e-91EF012819.1 Lotus japonicus nodulation signaling pathway 1 protein (nsp1) gene, complete cds.
GenBankEF0173723e-91EF017372.1 Lotus japonicus truncated nodulation signaling pathway 1 protein (nsp1) gene, nsp1-1 allele, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003627294.22e-30nodulation-signaling pathway 1 protein
SwissprotQ4VYC82e-30NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA1DR753e-31A1DR75_LOTJA; Truncated nodulation signaling pathway 1 protein
STRINGAET017701e-28(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-20GRAS family protein
Publications ? help Back to Top
  1. Heckmann AB, et al.
    Lotus japonicus nodulation requires two GRAS domain regulators, one of which is functionally conserved in a non-legume.
    Plant Physiol., 2006. 142(4): p. 1739-50
    [PMID:17071642]
  2. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  3. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]