PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v2518940.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family MYB_related
Protein Properties Length: 436aa    MW: 48096.4 Da    PI: 6.5149
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v2518940.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-162569147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a k++G   W +I +++g ++++ q++s+ qk+
  Lj3g3v2518940.1 25 RERWTEEEHNRFLEALKLHGRA-WQRIEEHIG-TKSAVQIRSHAQKF 69
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-161975IPR009057Homeodomain-like
PROSITE profilePS5129419.6912074IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-82271IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-152372IPR006447Myb domain, plants
SMARTSM007172.3E-122472IPR001005SANT/Myb domain
PfamPF002491.2E-132568IPR001005SANT/Myb domain
CDDcd001671.08E-92770No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MDAADSSSEE VIVKTRKPYT ITKQRERWTE EEHNRFLEAL KLHGRAWQRI EEHIGTKSAV  60
QIRSHAQKFF TKLEKEALVK GVPIGQAIDI DIPPPRPKRK PSNPYPRKSS AVTATLQSGE  120
KDVKLNSVES SHVESSHVKL TLDLEKEPLP EKHNVDEGPT TVKENKDGDH LEVFTVGPDV  180
PYSSVSSANK SSVSTSVPWG SSGALKEITP SLKEVIALDG TNESFITIEL GNRKLATNDG  240
KQTNGCSKDS KLEDSEASQV KLVQSEKTDG LNCAFTIDGM QSNQNYPRHV TVQVFDGNVS  300
TNTQNPSQDM RLRDSIFQPI GEVNGQPKVF TNSAASNTGE SQSNTGQSSI HQSFLPYPPF  360
TQHNQDDYQS FIHMSSTFSS LVVSNLLQNP AAHAAASFAA TYWPHARPET LADSSRCSEG  420
GFPCRQWALL QVWQLL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.106240.0cell culture| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj3g3v2518940.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027337706.10.0protein LHY-like isoform X2
RefseqXP_027337707.10.0protein LHY-like isoform X2
TrEMBLC0SNP10.0C0SNP1_SOYBN; Late elongated hypocotyl and circadian clock associated-1-like protein 1
TrEMBLI1MKB10.0I1MKB1_SOYBN; Uncharacterized protein
STRINGGLYMA16G01980.80.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.32e-45MYB_related family protein