PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v2315420.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GATA
Protein Properties Length: 360aa    MW: 39529.7 Da    PI: 6.788
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v2315420.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.48.1e-18240274135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C +Cg+ kTp+WR gp g+ktLCnaCG+++++ +l
  Lj3g3v2315420.2 240 CLHCGAEKTPQWRTGPMGPKTLCNACGVRFKSGRL 274
                      99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.255234270IPR000679Zinc finger, GATA-type
SMARTSM004011.8E-15234284IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.52E-13236297No hitNo description
Gene3DG3DSA:3.30.50.103.3E-14238271IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.45E-13239286No hitNo description
PROSITE patternPS003440240265IPR000679Zinc finger, GATA-type
PfamPF003202.1E-15240274IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MEAPEYFVGG YYGAGGQDQF SPAEKRHTDQ KPGEPFAIDD LFDFSNADAI MSDGFFDNVA  60
GNSTDSSTVT AVDSCNSSIS GGDNNRFAAA IVPRGFASDL HLSGELCVPQ YDEMAELEWL  120
SNFVEDSFSA EEELRTLKLL SGAAATTTVG TKPQTPESSS STDTLPPFAA DDSTRNAPFL  180
ISETPLPGKA RSKRSRPAPG DWSTRLLHLV SPSDAPSQQQ KVAPVKKREG LNTECTGRKC  240
LHCGAEKTPQ WRTGPMGPKT LCNACGVRFK SGRLVAEYRP AASPTFVSAR HSNSHRKVLE  300
LRRQKDMQRQ QQQQLMSQSS IFGGSNGGDE FMIRHHHQHH HHQQQQQQQQ HCGPEFRHVI
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj3g3v2315420.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027906617.10.0GATA transcription factor 9-like
TrEMBLA0A4D6MML40.0A0A4D6MML4_VIGUN; Transcription factor
STRINGXP_007135644.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13643395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.16e-62GATA transcription factor 9