PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v1393570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 538aa    MW: 60342.3 Da    PI: 7.0543
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v1393570.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.44e-30245302260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      +Dgy+WrKYG K+vkgse+prsYY+Ct+++C++kkkve+s  +++++ei+Y+g+Hnh+k
  Lj3g3v1393570.1 245 EDGYKWRKYGEKQVKGSENPRSYYKCTHPSCTMKKKVEKSV-EGHITEIVYKGTHNHPK 302
                      7****************************************.***************85 PP

2WRKY1023.4e-32394452159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vkg+++prsYY+C ++gC v+k++er+a+d k+v++tYeg+Hnh+
  Lj3g3v1393570.1 394 LDDGYRWRKYGQKVVKGNPNPRSYYKCVTPGCAVRKHIERAANDMKAVITTYEGKHNHD 452
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.7E-26234303IPR003657WRKY domain
SuperFamilySSF1182903.01E-23241303IPR003657WRKY domain
SMARTSM007741.9E-31244302IPR003657WRKY domain
PfamPF031068.0E-23245301IPR003657WRKY domain
PROSITE profilePS5081122.079245303IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.7E-36379454IPR003657WRKY domain
SuperFamilySSF1182905.75E-28386454IPR003657WRKY domain
PROSITE profilePS5081137.126389454IPR003657WRKY domain
SMARTSM007741.3E-35394453IPR003657WRKY domain
PfamPF031061.8E-24395452IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MVVFMTCHKM HHSLSSSFSP NSKFKVQTTT FNFLPQFFTM SFSFSNLLSN NNNNDYNLTM  60
DHDEDDKQRT SQNNDNFKSF APPSLSLSPF STTSDFPPGF SPSEFFNSPM FSSPNIPASY  120
TTTEPCSAQS QSMNQMNSST EEEENRNYSE LTFQNQTRQM PLFQSSTNMS EMEPLKKQDT  180
MTSNETAKQI EFSFEETAVK SENPSTQSFF SSELTTIKPE VQPNSGHFNP SNASMSIREQ  240
QRRSEDGYKW RKYGEKQVKG SENPRSYYKC THPSCTMKKK VEKSVEGHIT EIVYKGTHNH  300
PKPQSTKRTS SQSILQASVS CNNSGISELS MGEEDLDQTS QLSYSGGNDD DLGPDAKRWK  360
GEDENDGYSY SAPGSRTVKE PRVVVQTTSE IDILDDGYRW RKYGQKVVKG NPNPRSYYKC  420
VTPGCAVRKH IERAANDMKA VITTYEGKHN HDVPVGRGIA SHNINRTSLN SNTTNIATPA  480
PIRPSVVTNC SSSASFANSL HDSKLEMSGN QEYFHVNKLF NPGSFGYSGL NRSMGSYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-36245454877Probable WRKY transcription factor 4
2lex_A3e-36245454877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.104460.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj3g3v1393570.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027336197.10.0probable WRKY transcription factor 33
TrEMBLA0A371FLT60.0A0A371FLT6_MUCPR; WRKY transcription factor WRKY24 (Fragment)
STRINGXP_007134624.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF107734114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-94WRKY DNA-binding protein 33