PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v1355760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 351aa    MW: 39518.1 Da    PI: 8.1147
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v1355760.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.3e-3166119255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtp+LH rF++av++LGG+e+AtPk +l+lm++kgL+++hvkSHLQ+YR+
  Lj3g3v1355760.1  66 PRLRWTPDLHLRFLHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRS 119
                      8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.08862122IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.3E-2962120IPR009057Homeodomain-like
SuperFamilySSF466891.09E-1465120IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-2366121IPR006447Myb domain, plants
PfamPF002491.5E-967118IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MDLRVEERDD SECSKTSPSK EDGCEMSEED ESKQNTNNNG GSSSNSTVEE NDKKGSVRPY  60
VRSKLPRLRW TPDLHLRFLH AVQRLGGQER ATPKLVLQLM NIKGLSIAHV KSHLQMYRSK  120
KISDTSQESG DRNVYNLSQL PMLQGYNPSQ SSSYRCGYGD ASFAMYENML HRPFMGRGSA  180
DKSMAEFHGR MIESIHGINS NINWTNSTLF QVHPSNFSET STTKVHELQD KFLSFGSYGS  240
QVSLSQIDLH PSPQVKPSAQ ELMPITKPAN SVEKTLKRKV SDIDLDLDLS LKLSSRNQES  300
IEDHKVDSNL SLSLFSQSST SSYLSRRLKE TPDFSTEQRK KRASNALDLS I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-1767121458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-1767121458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-1767121357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-1767121357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-1767121357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-1767121357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-1767121458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-1767121458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-1767121458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-1767121458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-1767121458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-1767121458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj3g3v1355760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150376e-57AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006602682.11e-144putative two-component response regulator ARR21 isoform X2
TrEMBLK7MTM61e-142K7MTM6_SOYBN; Uncharacterized protein
STRINGGLYMA18G43550.21e-140(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.17e-53G2-like family protein