PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v1075120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GATA
Protein Properties Length: 289aa    MW: 32247.8 Da    PI: 9.1397
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v1075120.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.78e-19224257134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      C +C +tkTp+WR+gp g+ktLCnaCG++yr+ +
  Lj3g3v1075120.1 224 CMHCEVTKTPQWREGPMGPKTLCNACGVRYRSGR 257
                      99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577167.13E-15217279No hitNo description
SMARTSM004015.2E-17218268IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.503218254IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.0E-14222255IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.45E-14223270No hitNo description
PfamPF003201.2E-16224257IPR000679Zinc finger, GATA-type
PROSITE patternPS003440224249IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MNDSWLLDEM LDDPKFFDFP MEDLEPNAME EDWAAQFKRL NEPCFDAFSV VAPLGHCGET  60
QNEKPQLGKG FPASCTGISP IKQPRKTSGP TYGKTIPKQN VAFNGKDLHR LRTYSPVSVF  120
ESSSSSSVEN SNFDLPVIPA KRARSKRLRP SSCSSLFSVP FILNSPALRK HQSTPASESD  180
LETGDAEKLL NKAKKQRKKD LFMLSDDAEM KRFSSQGSAV PRKCMHCEVT KTPQWREGPM  240
GPKTLCNACG VRYRSGRLFP EYRPAASPTF VPAVHSNCHK KVLEMRGAI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.64780.0cell culture| pod| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj3g3v1075120.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0096490.0AP009649.1 Lotus japonicus genomic DNA, chromosome 3, clone: LjT10E18, TM0035, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020232632.11e-127GATA transcription factor 11
TrEMBLA0A151S5F91e-126A0A151S5F9_CAJCA; GATA transcription factor 6
STRINGGLYMA12G29730.11e-122(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57582849
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.22e-42GATA transcription factor 11