PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v0966230.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 158aa    MW: 18442.3 Da    PI: 10.1267
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v0966230.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.52.2e-52111321128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhP+deelv++yL kkv++++  l   + +vd++k+ePwd+p++v  + kewyf+++rd+kyatg r+nrat+sgyWkatgkd+++++
  Lj3g3v0966230.2  11 LPPGFRFHPRDEELVCDYLMKKVTHSDSLL---MIDVDLNKCEPWDIPACV--GGKEWYFYTQRDRKYATGLRTNRATSSGYWKATGKDRAIHR 99 
                      79**********************999544...789************776..779*************************************9 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +g+lvg++ktLvfy+grapkg+kt+Wvmhe+r+
  Lj3g3v0966230.2 100 -RGTLVGMRKTLVFYQGRAPKGRKTEWVMHEFRI 132
                      .999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-592156IPR003441NAC domain
PROSITE profilePS5100555.64211156IPR003441NAC domain
PfamPF023655.3E-2812132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MSNISMVEAK LPPGFRFHPR DEELVCDYLM KKVTHSDSLL MIDVDLNKCE PWDIPACVGG  60
KEWYFYTQRD RKYATGLRTN RATSSGYWKA TGKDRAIHRR GTLVGMRKTL VFYQGRAPKG  120
RKTEWVMHEF RIEGPHGPPK IPSSKEDWVL CRVFYKSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-49615712166NO APICAL MERISTEM PROTEIN
1ut4_B5e-49615712166NO APICAL MERISTEM PROTEIN
1ut7_A5e-49615712166NO APICAL MERISTEM PROTEIN
1ut7_B5e-49615712166NO APICAL MERISTEM PROTEIN
3swm_A4e-49615715169NAC domain-containing protein 19
3swm_B4e-49615715169NAC domain-containing protein 19
3swm_C4e-49615715169NAC domain-containing protein 19
3swm_D4e-49615715169NAC domain-containing protein 19
3swp_A4e-49615715169NAC domain-containing protein 19
3swp_B4e-49615715169NAC domain-containing protein 19
3swp_C4e-49615715169NAC domain-containing protein 19
3swp_D4e-49615715169NAC domain-containing protein 19
4dul_A5e-49615712166NAC domain-containing protein 19
4dul_B5e-49615712166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.76090.0root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in the root tip and in lateral root initiation sites. Also detected in expanding cotyledon, and in leaf primordia. {ECO:0000269|PubMed:11114891}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj3g3v0966230.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7256871e-167KF725687.1 Ammopiptanthus mongolicus NAC domain-containing protein (NAC3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003595973.11e-111NAC domain-containing protein 21/22
SwissprotQ84TE62e-88NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLF6KIF11e-109F6KIF1_MEDTR; NAC transcription factor-like protein
TrEMBLW0C8Y81e-109W0C8Y8_9FABA; NAC domain-containing protein
STRINGAES662241e-110(Medicago truncatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.27e-91NAC domain containing protein 1
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]