PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v0592190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 223aa    MW: 25385.8 Da    PI: 6.9287
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v0592190.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.51.2e-32149207159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh+
  Lj3g3v0592190.1 149 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHS 207
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.0E-34134207IPR003657WRKY domain
SuperFamilySSF1182901.12E-28141207IPR003657WRKY domain
PROSITE profilePS5081129.608144206IPR003657WRKY domain
SMARTSM007746.5E-38149208IPR003657WRKY domain
PfamPF031062.5E-25150206IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MEGERDHVPN FELQVSFTNT PQPITEMGFV DHFEENQVLS FLAPSAQSQS SQPLTGGGSN  60
DASTTAAAST LGFSHDDLVN RTSWNSNEQF QVRTIDPKAV SDENCTGNTS DGNNTWWRSG  120
GSEKSKVKVR RKLREPRFCF QTRSDVDVLD DGYKWRKYGQ KVVKNSLHPR SYYRCTHSNC  180
RVKKRVERLS EDCRMVITTY EGRHNHSPCD ESNSSEHECF TSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-26140206874Probable WRKY transcription factor 4
2lex_A2e-26140206874Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127133KVRRKLR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBMTransfer from AT2G44745Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj3g3v0592190.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM6220661e-151HM622066.1 Medicago truncatula STP mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027337675.11e-127probable WRKY transcription factor 12
SwissprotQ93WY43e-69WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A1S2Z5B81e-126A0A1S2Z5B8_CICAR; probable WRKY transcription factor 12
STRINGXP_004515333.11e-127(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72943245
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.11e-67WRKY family protein
Publications ? help Back to Top
  1. Yu Y, et al.
    MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering.
    Plant Sci., 2013. 212: p. 1-9
    [PMID:24094048]
  2. Yang L, et al.
    PtrWRKY19, a novel WRKY transcription factor, contributes to the regulation of pith secondary wall formation in Populus trichocarpa.
    Sci Rep, 2016. 6: p. 18643
    [PMID:26819184]
  3. Li W,Wang H,Yu D
    Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions.
    Mol Plant, 2016. 9(11): p. 1492-1503
    [PMID:27592586]
  4. Han Y, et al.
    WRKY12 represses GSH1 expression to negatively regulate cadmium tolerance in Arabidopsis.
    Plant Mol. Biol., 2019. 99(1-2): p. 149-159
    [PMID:30617455]