PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v0419510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 166aa    MW: 19134.7 Da    PI: 4.7003
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v0419510.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.97.5e-32105163159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDg++WrKYG+K+vk+s++pr+YYrC+ +gC+vkk+ver+++dp++v++tYeg+H+h+
  Lj3g3v0419510.1 105 LDDGFKWRKYGKKMVKNSPNPRNYYRCSVEGCRVKKRVERDRDDPSYVITTYEGTHTHP 163
                      59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.2E-3491163IPR003657WRKY domain
SuperFamilySSF1182901.44E-2898164IPR003657WRKY domain
PROSITE profilePS5081130.021100165IPR003657WRKY domain
SMARTSM007742.8E-37105164IPR003657WRKY domain
PfamPF031068.5E-26106163IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MTDKNPVSLP PDSPESDFIN QWPQELSEYL KLDDDNQWPD DDDHPDHSFA NSWHVLNQDN  60
QTNQVGDFGG SSSNVEGSST NVNIEDEKAV KEKVSFKTKS EVEILDDGFK WRKYGKKMVK  120
NSPNPRNYYR CSVEGCRVKK RVERDRDDPS YVITTYEGTH THPSSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-2595162774Probable WRKY transcription factor 4
2lex_A9e-2595162774Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00531DAPTransfer from AT5G26170Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj3g3v0419510.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0103621e-132AP010362.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjT12P09, TM1929, complete sequence.
GenBankAP0103631e-132AP010363.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjT61C17, TM2005, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004501445.21e-66probable WRKY transcription factor 50 isoform X1
SwissprotQ8VWQ59e-43WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLA0A2K3L8P82e-66A0A2K3L8P8_TRIPR; WRKY transcription factor
STRINGXP_004501445.17e-66(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112034110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.14e-34WRKY DNA-binding protein 50
Publications ? help Back to Top
  1. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]