PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v3338910.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 492aa    MW: 53585.8 Da    PI: 6.6595
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v3338910.3genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY83.32.4e-26110166259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +DgynWrKYGqK+vkg+ef rsYY+Ct+++C++kk++++ + ++++++ +  g+Hnh+
  Lj2g3v3338910.3 110 KDGYNWRKYGQKHVKGNEFIRSYYKCTHPSCQAKKQLQQLN-NGQITDSICIGQHNHP 166
                      7***************************************9.***************8 PP

2WRKY97.58.7e-31282340159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +dDgy+WrKYGqK v+g+++prsYYrC+ +gC +kk+ver+++d k+v++tYeg+H he
  Lj2g3v3338910.3 282 VDDGYRWRKYGQKLVRGNTNPRSYYRCSNPGCFAKKHVERASHDSKIVITTYEGHHCHE 340
                      59*******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.1E-23103168IPR003657WRKY domain
PROSITE profilePS5081119.084104168IPR003657WRKY domain
SuperFamilySSF1182903.66E-22105168IPR003657WRKY domain
SMARTSM007741.0E-27109167IPR003657WRKY domain
PfamPF031063.5E-21110166IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.3E-32272342IPR003657WRKY domain
SuperFamilySSF1182902.22E-27274342IPR003657WRKY domain
PROSITE profilePS5081133.247277342IPR003657WRKY domain
SMARTSM007742.9E-35282341IPR003657WRKY domain
PfamPF031069.1E-24283339IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MVSSDGSVDH KASSDEAQQR ASPHGDVTLS EQGICDTEIH LSKPEGARST LSIVAENAGK  60
DSDSTACALQ SGQEGSPSPL EKHLHSPDTS LHESQSGQHS PAIVREKVTK DGYNWRKYGQ  120
KHVKGNEFIR SYYKCTHPSC QAKKQLQQLN NGQITDSICI GQHNHPRPQL DTAQPVHSVL  180
PVAEQGPQKP SLTNVEDKSS VEHGCQPLEV KPLHSLPASK VSPADDLKAT HLQLKVKDEA  240
HSNEDSASKR LKKENGNAAA AGVDLPTRGP RVVHTSSEVD FVDDGYRWRK YGQKLVRGNT  300
NPRSYYRCSN PGCFAKKHVE RASHDSKIVI TTYEGHHCHE IPSARSVTTH NSAIDTHAMA  360
TNGKSGTKYE GSIVRVDSGS KSRLDEQQNE EPITSKSKVG DTVEFCAVSL SNEGHETKLK  420
EQEQQNDDSG AKDDSVSSDI ICHSSSEGPC RTNEQLKDEV KTTSEGSKDC LNVVAVDVHN  480
QQPKSDPEPV QS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-29273343878Probable WRKY transcription factor 4
2lex_A3e-29273343878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEXTransfer from AT2G04880Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj2g3v3338910.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020234360.10.0WRKY transcription factor 1
RefseqXP_028200408.10.0WRKY transcription factor 1-like
TrEMBLA0A0B2SJM80.0A0A0B2SJM8_GLYSO; WRKY transcription factor 1
STRINGGLYMA02G47650.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.21e-76zinc-dependent activator protein-1