PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v3246860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 581aa    MW: 62985.6 Da    PI: 7.219
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v3246860.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.26.1e-32222279260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      +DgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h+k
  Lj2g3v3246860.1 222 NDGYNWRKYGQKLVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIVYKGTHDHPK 279
                      8****************************************.***************85 PP

2WRKY106.21.7e-33396454159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  Lj2g3v3246860.1 396 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 454
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081124.088216280IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.9E-27217280IPR003657WRKY domain
SuperFamilySSF1182903.14E-25218280IPR003657WRKY domain
SMARTSM007741.9E-33221279IPR003657WRKY domain
PfamPF031069.3E-25222278IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.2E-37381456IPR003657WRKY domain
SuperFamilySSF1182902.09E-29388456IPR003657WRKY domain
PROSITE profilePS5081138.825391456IPR003657WRKY domain
SMARTSM007743.1E-39396455IPR003657WRKY domain
PfamPF031063.5E-26397454IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MDATAATTSS GETDDPNRTG SGQNSNSTAR YKLFSPAKLP ISRSPCITIP PGLSPSSFLE  60
SPVLLSNMKV EPSPTTGSFA KLFQTVHGST ASNASVTFPV TTVCFNTSAV DEGKSSFFEF  120
KPHNRSNMPP ADFNNHVNEQ PTHVEGPGKA QPLTTSPLVE SELAVLSNEL SLSSPGQMVS  180
SGASAPVDFN SDEFNHKCTG LQTSHADVRG SGLLVAAEKV TNDGYNWRKY GQKLVKGSEF  240
PRSYYKCTHP NCEVKKLFER SHDGQITEIV YKGTHDHPKP QPSSRSSAGS IMSMQGERSD  300
MTSSAGRDDK ASNVYGHVSH EAEPNSTPEL SPVATNDDSQ ECAGFVSNRT NEEVDDDDPF  360
PKRRKMELGN VDIIPIVKPI REPRVVVQTL SEVDILDDGY RWRKYGQKVV RGNPNPRSYY  420
KCTNAGCPVR KHVERASHDP KAVITTYEGK HNHDVPAARN SSHDMVGHVA AGGNTRIKLE  480
QSDTISLDLG MGITTSAAEN RSNGQGKMVL SEFGHSQNTH PSTSNFKFVH TSPAPGYYGV  540
LNNSSSSYGS RENRSDGPSL NHSSYPCSQN MGRLLMGPRN C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-37211457678Probable WRKY transcription factor 4
2lex_A2e-37211457678Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.224800.0root
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj2g3v3246860.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003519618.10.0probable WRKY transcription factor 20 isoform X1
RefseqXP_028221428.10.0probable WRKY transcription factor 20 isoform X1
SwissprotQ93WV00.0WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A445LW230.0A0A445LW23_GLYSO; Putative WRKY transcription factor 20 isoform A
TrEMBLI1JJG70.0I1JJG7_SOYBN; Uncharacterized protein
STRINGGLYMA02G46690.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39463463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-175WRKY family protein