PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v3055290.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HB-other
Protein Properties Length: 494aa    MW: 56183.4 Da    PI: 7.5801
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v3055290.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.55.4e-192075257
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                     +kR   t+ ql +Le+++  ++yps+e++ +LA+++gLte+qV+ WF+ rR k+k+
  Lj2g3v3055290.2 20 KKRKLKTPAQLMALEKFYDAHKYPSEEKKLKLAEEIGLTEKQVSGWFCHRRLKDKR 75
                     89****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-20275IPR009057Homeodomain-like
SuperFamilySSF466895.99E-181580IPR009057Homeodomain-like
PROSITE profilePS5007117.2811676IPR001356Homeobox domain
SMARTSM003894.3E-191880IPR001356Homeobox domain
PfamPF000461.4E-162075IPR001356Homeobox domain
CDDcd000869.34E-172075No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MEESSEVKSE ENKVSMEKNK KRKLKTPAQL MALEKFYDAH KYPSEEKKLK LAEEIGLTEK  60
QVSGWFCHRR LKDKRLLKDE AVANGRQDRS SGVIQDRGSG LGQDSCGSSK HGDNKHLDPK  120
EAESHGIYNQ DISVADMTYG RRDYYPENGR GMDDTSSESS SFLQERLYSQ GQDPYDMEPS  180
RHRTPSGSLP PLNPKSATKM GYKPSGYLKV KGEIEHAAIT AVKKQLGRHY LEDGPLLGVE  240
FDPLPPGAFE FQTEYPVHEA YHVANPVHLN SPEVPAVKRQ PNLSSRHDSY YTKFSSQDSH  300
MEGVDFGFLQ DYDVQDTQDK KARQDINYSQ TFYNDANNFP GRNSSQDLYE DSTREVSAYN  360
SSKNHKMGKG NKRGVEGMRS YSTSNHRDHY EDDIAVKPTD ILLLEYDNID PKNVQRSEHV  420
KSKPSNSIRK SRVPMDPEER GLSTRMAKEE VFKGDRKAKK KYRNADGVGM LSNEIAVLDV  480
LQNELKLVRH KNTM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003545402.10.0PREDICTED: uncharacterized protein LOC100803515
TrEMBLA0A151U2400.0A0A151U240_CAJCA; Homeobox protein NANOG (Fragment)
STRINGGLYMA14G03850.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.11e-73HB-other family protein