PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v2807730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family LBD
Protein Properties Length: 168aa    MW: 18796.3 Da    PI: 5.5928
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v2807730.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.28.2e-4581071100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +Ca+Ck+lrr+C+kdC++apyfpa++p+kfa+vhk+FGasnv+k+l+++p ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q+++l+ +l
  Lj2g3v2807730.1   8 PCASCKLLRRRCTKDCTFAPYFPADEPQKFAIVHKVFGASNVSKMLQEIPVHQRADAVSSLVYEANARVRDPVYGCVGAISYLQNQVSELQMQL 101
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Lj2g3v2807730.1 102 AVAQTE 107
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.3987108IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-448105IPR004883Lateral organ boundaries, LOB
Gene3DG3DSA:2.105.10.105.5E-487150IPR015948Bacteriophage PRD1, P2, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MGGTGNSPCA SCKLLRRRCT KDCTFAPYFP ADEPQKFAIV HKVFGASNVS KMLQEIPVHQ  60
RADAVSSLVY EANARVRDPV YGCVGAISYL QNQVSELQMQ LAVAQTEILC IQMQQHEPVV  120
PTPEVNNPDQ KPYFLQDEFS QYLNFGSSSN VIYDSLQREN IYGHDMVS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014493648.11e-100PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW31e-73LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0B2PB861e-101A0A0B2PB86_GLYSO; LOB domain-containing protein 12
STRINGGLYMA18G02780.12e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.16e-75LBD family protein