PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v2535460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 425aa    MW: 47064.1 Da    PI: 7.9549
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v2535460.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.5e-32233286255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Lj2g3v2535460.1 233 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 286
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-15230286IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-28231286IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-23233286IPR006447Myb domain, plants
PfamPF002492.9E-7234285IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MTLEGVFIEP TSTTSTSPDL SLHISLPSSS NNNNNNYHES QNISSPNFPS RNVSQAHTEL  60
SLGRNFTGGG ATTTEAEKPH NNYHPFHPSL THFHHLHHHT NNNNSSTTTT PLNGLNYGLS  120
LLDVSPEGLR PIKGIPVYHN RSFPYLDKDH HHNKMCLYHP IPSSSSSPSP YLAAAASRVN  180
GLISGEAFRS NHQLHHHSVL HGVGPSSHET SSGFNMRSRF LPKLPTKRSM RAPRMRWTTT  240
LHARFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH LQMYRTVKTT DKPIASSGHS  300
DGSGEDELSP MGSSVDRGGL SQFSDHRDRT DRAMHQDMEH LSSTTTTLWS NSSSCGEPWL  360
RTTSNNIDGL RPPILHSQTI SRGHQIQECD PTQLKNGLPC STLEYKNPSL EFTLGRPDWN  420
GKEQA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-16234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-16234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-16234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-16234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-16234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-16234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-16234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-16234288458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj2g3v2535460.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027939271.11e-170transcription repressor KAN1-like
TrEMBLA0A371FF131e-168A0A371FF13_MUCPR; Transcription repressor KAN1 (Fragment)
STRINGGLYMA14G39260.21e-163(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-52G2-like family protein