PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v2314850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 1232aa    MW: 140831 Da    PI: 6.3945
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v2314850.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY82.44.5e-26594650258
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                      +Dg++WrKYGqK+++ s++pr+YYrCt ++C +kk+v+r ++ p++ e+tY++eH++
  Lj2g3v2314850.1 594 EDGFTWRKYGQKVIHASKYPRNYYRCTRQKCLAKKRVQRLDDTPEIYEVTYRNEHTC 650
                      7******************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF747886.8E-69231553IPR016159Cullin repeat-like-containing domain
PfamPF030812.6E-65318554IPR004140Exocyst complex protein Exo70
Gene3DG3DSA:2.20.25.803.1E-25592651IPR003657WRKY domain
SuperFamilySSF1182907.45E-24592651IPR003657WRKY domain
SMARTSM007745.0E-33593652IPR003657WRKY domain
PROSITE profilePS5081120.392594648IPR003657WRKY domain
PfamPF031061.1E-22594650IPR003657WRKY domain
SuperFamilySSF747882.04E-748081232IPR016159Cullin repeat-like-containing domain
PfamPF030811.0E-728951232IPR004140Exocyst complex protein Exo70
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006887Biological Processexocytosis
GO:0000145Cellular Componentexocyst
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1232 aa     Download sequence    Send to blast
MTRWLIQILS WLMQPNVWRF VSFASAVVGL LCNALSSSFN HLFGDWTFFK ISLYSVFSVI  60
MSLMMLFAKK WRHSRSLQFK AHLAFLVLTI TSLYSFISDK VMNGKPDVYS LISCAAFAIM  120
SLSISRQIQC GFEVDLLYFF LGCLMVQLMK TKLVLVIVGA GFSYSLIVLR SSFSSIDGLP  180
KIDHIPAPQE EPSIDILVDS QHLARTDIAS VTQQLSTHLK DLQQHDSNLR KLLLERVKEY  240
LEHNSELVAT DHNFIIDALP SETLNKFHKT AKLMVEAGFE KVFFAVYSSW REEWLKNLLG  300
DTHKMAWQDL KDETGFGRWV KASNVALKIL FPNERQLCDR ILLGFSSAAD FSFTEVCRGS  360
VIQLLNFADV VAIGKRSLQR LSRILEVFET LTELIPEYES LFCDQYSLSL RNKAITIWKR  420
LGEAIRGILN VLESLVWRDP AKEAAPGGAV HPFTRYVMYY LQETCRSWQT LEKVFENYSL  480
SAQMHWIIEL LESNLEAKST FYKDPAVGFV FLMNNGDYIV QKAKDSELGT LLGDDWIQKH  540
TTKVRQYLLQ FRRTMTKQSA ATSVQDLPGR TKNAPERTVR FPAPQVGDLG MPPEDGFTWR  600
KYGQKVIHAS KYPRNYYRCT RQKCLAKKRV QRLDDTPEIY EVTYRNEHTC YMSLAEPSLL  660
LPSQQVDISK YMTQPTMSLQ FSPSSSSVSG QSFKNLVQQL SGSGSTGGGV GPSTSEYSTD  720
YPIADMVDAM FTSSCSNVSS VASFVPFAED KWEPDGAPEN EHSEVIEVDS PQLVSTDIAG  780
MMQQLSNCMK GLQQHDCKLT NILLMPKEHV DDKSMLLRTD INFVIDALPS ERINSLHKTV  840
KLMVASGFEE ECSKVYSSWR RRWLEECLIN KLLELQENEI ENEHEKKTCL DKRVERWIEA  900
SQVALLILFR EWRLCNRIFS GFSSAADSCF TQVCQGPMIQ MLNFAAAVAD GSPSAYRLFK  960
ILDMFMTLNA LIPEFQSLLF PNPLVNEAIA VQNRLGEASR DLFMEFEILV FDIPEVKLLA  1020
PPNGGHHPMM NNIVAYLNSA YRSQQILEQI LQQYPKVATG AETSSFMTQM KRTLKLLEKT  1080
LVEKSENYKD PALPYFFMMN NWRLIEVALG TMYGHDLFQN NRAKVQKNLE QYRGSSWNKM  1140
LDILKVESNE SEAPNVAADL MKDKLNLFNM HFEEICRVQS TWSVIDEQLR EEIRISVNDI  1200
LLPAYGNFIG RFQDVLGKHA YEYIEYGLFD IE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4rl5_A2e-522591232129548Exocyst complex component EXO70A1
4rl5_B2e-522591232129548Exocyst complex component EXO70A1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.38791e-167floral bud| pod
Functional Description ? help Back to Top
Source Description
UniProtComponent of an exocyst subcomplex specifically involved in autophagy-related, Golgi-independent membrane traffic to the vacuole. Regulates autophagosome formation and autophagy-related Golgi-independent import into the vacuole. Positive regulator of both abscisic acid (ABA)-promoted and mannitol (drought)-promoted stomatal closure (PubMed:27956469). {ECO:0000269|PubMed:23944713, ECO:0000269|PubMed:27956469}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj2g3v2314850.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004490669.10.0uncharacterized protein LOC101500706 isoform X2
SwissprotQ9FGH91e-115E70B1_ARATH; Exocyst complex component EXO70B1
TrEMBLA0A1S2XKF60.0A0A1S2XKF6_CICAR; Exocyst subunit Exo70 family protein
STRINGXP_004490668.10.0(Cicer arietinum)
STRINGAES988540.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF174145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40740.15e-25WRKY DNA-binding protein 55
Publications ? help Back to Top
  1. Synek L, et al.
    AtEXO70A1, a member of a family of putative exocyst subunits specifically expanded in land plants, is important for polar growth and plant development.
    Plant J., 2006. 48(1): p. 54-72
    [PMID:16942608]
  2. Li S, et al.
    Expression and functional analyses of EXO70 genes in Arabidopsis implicate their roles in regulating cell type-specific exocytosis.
    Plant Physiol., 2010. 154(4): p. 1819-30
    [PMID:20943851]
  3. Wang J, et al.
    EXPO, an exocyst-positive organelle distinct from multivesicular endosomes and autophagosomes, mediates cytosol to cell wall exocytosis in Arabidopsis and tobacco cells.
    Plant Cell, 2010. 22(12): p. 4009-30
    [PMID:21193573]
  4. Kulich I, et al.
    Arabidopsis exocyst subcomplex containing subunit EXO70B1 is involved in autophagy-related transport to the vacuole.
    Traffic, 2013. 14(11): p. 1155-65
    [PMID:23944713]
  5. Stegmann M, et al.
    The exocyst subunit Exo70B1 is involved in the immune response of Arabidopsis thaliana to different pathogens and cell death.
    Plant Signal Behav, 2013. 8(12): p. e27421
    [PMID:24389869]
  6. Tzfadia O,Galili G
    The Arabidopsis exocyst subcomplex subunits involved in a golgi-independent transport into the vacuole possess consensus autophagy-associated atg8 interacting motifs.
    Plant Signal Behav, 2013. 8(10): p. doi: 10.4161/psb.26732
    [PMID:24494242]
  7. Zhao T, et al.
    A truncated NLR protein, TIR-NBS2, is required for activated defense responses in the exo70B1 mutant.
    PLoS Genet., 2015. 11(1): p. e1004945
    [PMID:25617755]
  8. Hong D,Jeon BW,Kim SY,Hwang JU,Lee Y
    The ROP2-RIC7 pathway negatively regulates light-induced stomatal opening by inhibiting exocyst subunit Exo70B1 in Arabidopsis.
    New Phytol., 2016. 209(2): p. 624-35
    [PMID:26451971]
  9. Seo DH,Ahn MY,Park KY,Kim EY,Kim WT
    The N-Terminal UND Motif of the Arabidopsis U-Box E3 Ligase PUB18 Is Critical for the Negative Regulation of ABA-Mediated Stomatal Movement and Determines Its Ubiquitination Specificity for Exocyst Subunit Exo70B1.
    Plant Cell, 2016. 28(12): p. 2952-2973
    [PMID:27956469]
  10. Sabol P,Kulich I,Žárský V
    RIN4 recruits the exocyst subunit EXO70B1 to the plasma membrane.
    J. Exp. Bot., 2017. 68(12): p. 3253-3265
    [PMID:28338727]
  11. Liu N, et al.
    CALCIUM-DEPENDENT PROTEIN KINASE5 Associates with the Truncated NLR Protein TIR-NBS2 to Contribute to exo70B1-Mediated Immunity.
    Plant Cell, 2017. 29(4): p. 746-759
    [PMID:28351987]