PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1989050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GATA
Protein Properties Length: 540aa    MW: 59768.1 Da    PI: 6.9947
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1989050.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.46.2e-16741135
             GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                     C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Lj2g3v1989050.1  7 CYHCGVTSTPLWRNGPPEKPILCNACGSRWRTKGT 41
                     ****************66666***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004018.5E-10153IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.19E-11546No hitNo description
CDDcd002022.27E-16653No hitNo description
Gene3DG3DSA:3.30.50.102.5E-12741IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
PfamPF003209.9E-14741IPR000679Zinc finger, GATA-type
PfamPF139195.1E-10283369IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPILCN ACGSRWRTKG TLVNYTPLHA RPETDDYEDQ  60
KVFRVKSISL NKNKEGKPLK RKQNHDNLVS GGVAPYYNQG FPKVVDEDTS NRSSSGSAIS  120
NSESCAQFGG TEASDLTGPA QSVVWETMVP SKKRTCVGRP KPSSVEKLTQ DLCTILHEQQ  180
SYFSASSEED LLFESETPMV SVEIGHGSML FRHPSCIARD EESEASSLSV DNKQCPISEA  240
YSYSGAMLVH NSSSPMNFSS QGVEKVRNSA DHGMHQEQLK SDKSQLERVQ MLGNHDSPLC  300
LIDLNDVVNY EEFLRILTNE EQQQLLKFLP VVDTAKLPDS LKAMFDSSQF KENLTYFQQL  360
LSEGVFDISL SGAKPEDCKT LKRFALSNLS KLKWVEHYHF LKRCKRRPGK SGTPGSTSTS  420
STNVANIKRV RDSWNQNFPE LKPIMRNPKR VITKAGCEGK EVVEDGASNS PKSLFPLPRA  480
ASSLFLDSLN FAEESSDQDL LLDVPSNSSF PQAELLCPTL SFGAQASTSS SSAYSHLVHR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1400406LKRCKRR
2400407LKRCKRRP
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj2g3v1989050.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1421430.0BT142143.1 Lotus japonicus clone JCVI-FLLj-21H9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027360178.10.0GATA transcription factor 26
SwissprotQ8W4H11e-149GAT26_ARATH; GATA transcription factor 26
TrEMBLA0A445HWL20.0A0A445HWL2_GLYSO; GATA transcription factor 26 isoform A
STRINGGLYMA11G04060.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44243155
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-148GATA transcription factor 26