PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1902070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family MYB_related
Protein Properties Length: 116aa    MW: 13312.2 Da    PI: 10.3346
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1902070.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.82.5e-133882147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Lj2g3v1902070.1 38 RENWTEPEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 82
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.1093387IPR017930Myb domain
SuperFamilySSF466899.72E-173388IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-193685IPR006447Myb domain, plants
SMARTSM007174.8E-103785IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-63882IPR009057Homeodomain-like
PfamPF002496.7E-113882IPR001005SANT/Myb domain
CDDcd001679.33E-84083No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
MVSENPNASE AIYLEPLADS VEDPAKKTRK PFTITKSREN WTEPEHDKFL EALQLFDRDW  60
KKIEAFVGSK TVIQIRSHAQ KYFLKAQKSG KSEHLPPPRP KRKAAHPYPQ KASKNG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.65245e-71floral bud| flower| pod| protoplast| root
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj2g3v1902070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0097881e-83AP009788.1 Lotus japonicus genomic DNA, clone: LjT02J13, TM2022, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_029126456.11e-68protein REVEILLE 6 isoform X4
SwissprotQ8H0W32e-56RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A151U6K45e-67A0A151U6K4_CAJCA; Myb-like protein G
STRINGGLYMA20G30250.13e-64(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.19e-45MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]