PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1828460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 760aa    MW: 82309.1 Da    PI: 7.045
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1828460.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-095235601954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Lj2g3v1828460.1 523 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 560
                      664559******************************88 PP

2BELL118.72.7e-38383454172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      +r e+q++k+kLl +l+eVd+rY++y+eq+q+v++sF+ ++g g+a pYt+lA+ka+SrhFrcLk+aia q+
  Lj2g3v1828460.1 383 DRIEHQRRKVKLLAMLDEVDRRYNHYCEQMQMVVNSFDLMMGFGAAVPYTALAQKAMSRHFRCLKEAIAAQL 454
                      589******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.4E-76317452IPR006563POX domain
PfamPF075267.9E-51322451IPR006563POX domain
PROSITE profilePS5007112.568501564IPR001356Homeobox domain
SMARTSM003891.2E-9504568IPR001356Homeobox domain
CDDcd000861.31E-12504565No hitNo description
SuperFamilySSF466895.13E-17506571IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.1E-29507570IPR009057Homeodomain-like
PfamPF059203.8E-18521560IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 760 aa     Download sequence    Send to blast
MGIATSPPLP SNILLSQQHS NSMSQDYHHH HQQQGIFTFS NGLERSAAPP SPQQIRRDNK  60
FRPQQSGFEA APALEAIEEG LPPVYETAGM LSEMFNFSPA TAAELLEQQH MSATFRSRPP  120
PQGVASSSEW YGGGGRNQNS HQHQITDSAA AMQLFLMNPP PPPSQTRSPS PPPHNRQAET  180
SSTLHMLLPN PAASSNSLQG FPGSGGSYGQ FTWVPENSQE AGGLNNNTPS EIGGVVEGQG  240
LSLSLSSSLQ HLEAAKAEEL RMGDNSGFLY FNQGAPSNSS SSSQYQYKTH NPSPQALHLQ  300
GGTIIHNHHQ GYGGSSLGAV NVLRNSKYVK AAQELLEEFC SVGRGQFKKS KFSNQNSSNP  360
GGGGGGGDSS KEAPPPPPLS AADRIEHQRR KVKLLAMLDE VDRRYNHYCE QMQMVVNSFD  420
LMMGFGAAVP YTALAQKAMS RHFRCLKEAI AAQLKHSCEV LGEKDGAGGS GLTRGETPRL  480
KMLEQSLRQQ RAFQQMGMME QEAWRPQRGL PERSVNILRA WLFEHFLHPY PSDADKHLLA  540
RQTGLSRNQV SNWFINARVR LWKPMVEEMY QQERKEVECA EERERNQSNS GQQQAQTPTT  600
PPSSATSTAP PPPTTTTTKP TGKRSDINAT ESDPSLHAIN RSQSFSENQA NHSATTTAIN  660
NATTASEVAP PVSQCFDSVS DDDLPPHRSI MAADDKCRHG SLVAADYGTA PASGGGGDIG  720
STLIRFGTTA GDVSLTLGLR HAGNTPEKTN SFSVRDFGGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16510568563Homeobox protein Meis2
3k2a_B1e-16510568563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.71340.0cell culture| floral bud| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0065410.0AP006541.1 Lotus japonicus genomic DNA, chromosome 2, clone: LjB06D23, BM0787, complete sequence.
GenBankAP0065380.0AP006538.1 Lotus japonicus genomic DNA, chromosome 2, clone: LjT18J10, TM0323a, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538830.10.0PREDICTED: BEL1-like homeodomain protein 4
RefseqXP_014619348.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ9SW800.0BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLA0A0B2SBB10.0A0A0B2SBB1_GLYSO; BEL1-like homeodomain protein 2
STRINGGLYMA11G06640.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35243257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-159BEL1-like homeodomain 2