PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1550000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family Trihelix
Protein Properties Length: 307aa    MW: 36230.6 Da    PI: 8.8596
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1550000.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix89.83e-2849130186
         trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                      +Wt+qe+++ i++r e+e+++ ++k++k+lWe vs+kmrergf+rsp+qCk+kw+nl +ryk  ++++ ++     ++cp+f++l+
  Lj2g3v1550000.1  49 QWTQQETREFIAIRAELERDFTASKRNKTLWEVVSSKMRERGFRRSPEQCKCKWKNLVNRYKGKETSDPEH----GKQCPFFEELH 130
                      7****************************************************************999986....678******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007177.5E-546108IPR001005SANT/Myb domain
PfamPF138373.6E-2448131No hitNo description
CDDcd122035.53E-2748113No hitNo description
PROSITE profilePS500907.7750106IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MFGGGGDDTL AARLGMVMPS MVNPSTSSMM SGEMSVAPVR EERGPSQPQW TQQETREFIA  60
IRAELERDFT ASKRNKTLWE VVSSKMRERG FRRSPEQCKC KWKNLVNRYK GKETSDPEHG  120
KQCPFFEELH AVFTQRAQNM QRLLLESENR SAQTKKGMKR LSGDRSSEEF SEDDEVGDES  180
EEERPARSNT RKRKASDKTA MEKSSKGNNP GNNTNSASIQ EMLKEFFQHQ LRMEMQWREM  240
MERRAHERQL FEQEWRQTME KLERERLMVE QAWREREEQR RIREENRAER RDALLTTLLN  300
KLIHESN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A3e-1550120777DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0091550.0AP009155.1 Lotus japonicus genomic DNA, chromosome 2, clone: LjT12C04, TM1523, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014521444.11e-179PREDICTED: trihelix transcription factor GT-3b-like
TrEMBLA0A0L9URU21e-176A0A0L9URU2_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T3G01e-176A0A0S3T3G0_PHAAN; Uncharacterized protein
STRINGGLYMA01G35370.21e-168(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.11e-37Trihelix family protein