PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1537380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GRF
Protein Properties Length: 339aa    MW: 37748.3 Da    PI: 9.5836
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1537380.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC66.14.7e-2187131145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRC +++ +++k+C+rH+ r r rsrk++e+
  Lj2g3v1537380.1  87 DPEPGRCRRTDGKKWRCAKDAHPDSKYCDRHMIRRRYRSRKPVES 131
                      79****************************************986 PP

2QLQ53.76.1e-193267237
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     +FT +Q+q+L++Q+l++KyL a++ vPp+Ll++i+k
  Lj2g3v1537380.1 32 PFTVSQWQELEHQALIFKYLKAGLSVPPDLLVPIRK 67
                     9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.2E-103167IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.6373267IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.7E-143266IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.66387131IPR014977WRC domain
PfamPF088793.6E-1888130IPR014977WRC domain
PROSITE patternPS000700280291IPR016160Aldehyde dehydrogenase, cysteine active site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
GO:0016491Molecular Functionoxidoreductase activity
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MPVSLSSIQP SFLKPQSQMM SVPPPPVMWP PPFTVSQWQE LEHQALIFKY LKAGLSVPPD  60
LLVPIRKSLQ LMSHPHSSLG YYGKKIDPEP GRCRRTDGKK WRCAKDAHPD SKYCDRHMIR  120
RRYRSRKPVE SQPQPSSSSS SSQLAASTAG SGSTAKTASA AVTTFQNNLP LHTNGAREGF  180
SFTLGNSTSQ LHMDTSKKPY RFELTNEAEE HSLLQKDLGS VKYQGYDFTS DGMWSHMHQI  240
PSNTISESRS GSAIVGNCFQ QRTTRDAELL NLDTARSKEL AFSGQVCSAG RLKQEYQSPQ  300
SLFSDWHWKK DLGSSATAYR PNKDFNCNPD INADSSGSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-48AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003516492.11e-160PREDICTED: growth-regulating factor 3-like
TrEMBLK7K3Y31e-160K7K3Y3_SOYBN; Uncharacterized protein
STRINGGLYMA01G35145.11e-160(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF149481112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-37growth-regulating factor 5