PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1536360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 244aa    MW: 27969.2 Da    PI: 6.8911
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1536360.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.46.5e-332276155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprlrWt +LH+rFv+av++LGG+ekAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Lj2g3v1536360.1 22 KPRLRWTADLHDRFVDAVTKLGGPEKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 76
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-311977IPR009057Homeodomain-like
PROSITE profilePS5129412.0271979IPR017930Myb domain
SuperFamilySSF466894.84E-162279IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-242277IPR006447Myb domain, plants
PfamPF002496.7E-92475IPR001005SANT/Myb domain
PfamPF143795.8E-23125170IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MESGGGREGY DGVVMMMTRD PKPRLRWTAD LHDRFVDAVT KLGGPEKATP KSVLRLMGLK  60
GLTLYHLKSH LQKYRLGQQA RKQSDEHYKE NNRCSYVNFS HRSSGPNTSY SYRGDKEDNE  120
GGEIPIAEAL RCQIEVQKRL EEQLEVQKKL QMRIEAQGKY LQAALEKAQR SISLDGSGTL  180
EASRAQLSEF NFALSNFMEN MNRDSKDDIM DMNDFYNKSH SSAFHYQGGE REDYEDQKPK  240
IEGE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A9e-192275154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-192275154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-192275154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-192275154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.224970.0root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj2g3v1536360.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0073061e-166AP007306.2 Lotus japonicus genomic DNA, chromosome 2, clone: LjT20J15, TM1492, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027913783.11e-144myb family transcription factor PHL11 isoform X1
SwissprotC0SVS43e-75PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLA0A4D6LS211e-143A0A4D6LS21_VIGUN; Two-component response regulator ARR-B family
STRINGXP_007158199.11e-141(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51013142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.18e-76G2-like family protein
Publications ? help Back to Top
  1. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]