PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1509440.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 376aa    MW: 42031.9 Da    PI: 9.5905
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1509440.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.8e-32195248255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Lj2g3v1509440.2 195 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 248
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15192248IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28193248IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-23195248IPR006447Myb domain, plants
PfamPF002492.5E-7196247IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PTTSSWKRST EEDMDLGFWK RALESRSSMS TSSMAKKDTG  60
FFDLSLSNPR PSESNTTIHH ANNAIANNSN NNHFQSFQQN HYFQPLFHQQ PLQHQSLSQE  120
LGFLRPIRGI PVYQNPPPMM PFTTQPHHLL EPSSTPSSLI SNTNTGSPTP NFPSQALMRS  180
RFLSRFPAKR SMRAPRMRWT TTLHARFVHA VELLGGHERA TPKSVLELMD VKDLTLAHVK  240
SHLQMYRTVK TTDRAAASSG QSDVYDNGSS GDNSDDLMFD INSSRRPELS IKQGRSNVVN  300
QEKECHGLWS NSSREAWLHG KPKNDSVGNT PSLEKEMDPK CLSYERISDG SSSSNLSGSS  360
PKKLNLDLGF TLGQPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-17196250458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-17196250458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-17196250458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-17196250458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-17196250458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-17196250458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-17196250458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-17196250458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in developing phloem. {ECO:0000269|PubMed:14561401}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj2g3v1509440.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027360426.10.0probable transcription factor KAN2 isoform X1
SwissprotQ9C6164e-95KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A371F7I00.0A0A371F7I0_MUCPR; Putative transcription factor KAN2 (Fragment)
STRINGXP_007158256.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59683452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.14e-66G2-like family protein
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]