PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1327450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HD-ZIP
Protein Properties Length: 280aa    MW: 32052.6 Da    PI: 6.6323
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1327450.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox573.2e-1874127356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Lj2g3v1327450.1  74 KKRRLNMEQVKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 127
                      456899***********************************************9 PP

2HD-ZIP_I/II1331.1e-4273163191
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                      ekkrrl+ eqvk+LE+sFe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr+yda+k++n++L++++++L++e+
  Lj2g3v1327450.1  73 EKKRRLNMEQVKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDLLKRQYDAIKSDNDALQAHNQKLQAEI 163
                      69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.33E-1965131IPR009057Homeodomain-like
PROSITE profilePS5007117.39469129IPR001356Homeobox domain
SMARTSM003891.8E-1872133IPR001356Homeobox domain
PfamPF000461.5E-1574127IPR001356Homeobox domain
CDDcd000862.03E-1674130No hitNo description
Gene3DG3DSA:1.10.10.601.4E-1976136IPR009057Homeodomain-like
PRINTSPR000311.1E-5100109IPR000047Helix-turn-helix motif
PROSITE patternPS000270104127IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5109125IPR000047Helix-turn-helix motif
PfamPF021836.0E-17129169IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MDFFPTNFML QTPHHDDHHQ PPPSLNSILP HDYHGGPAFL GKRSMSFSSG IEHGEEANNA  60
EEDLSDDGSQ AGEKKRRLNM EQVKTLEKSF ELGNKLEPER KMQLARALGL QPRQIAIWFQ  120
NRRARWKTKQ LEKDYDLLKR QYDAIKSDND ALQAHNQKLQ AEILALKNRE PTESINLNKE  180
TEGSSSNRSE NSSDIKLDIS RTPAIDSPLS THHHNSRTLF PPSARPAGSV AHQLFQSSSR  240
PDLQCQKMDH MVKEESLSNM FCGMDDQSGF WPWLEQQHFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1121129RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.57540.0floral bud| flower| pod| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in leaves and flowers. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj2g3v1327450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1404390.0BT140439.1 Lotus japonicus clone JCVI-FLLj-18M14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027914954.10.0homeobox-leucine zipper protein ATHB-13-like isoform X2
SwissprotQ8LC031e-118ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A4D6LR571e-179A0A4D6LR57_VIGUN; Homeobox-leucine zipper protein
STRINGXP_007157668.11e-178(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-109HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Chan RL
    Functional characterization of the homeodomain leucine zipper I transcription factor AtHB13 reveals a crucial role in Arabidopsis development.
    J. Exp. Bot., 2015. 66(19): p. 5929-43
    [PMID:26136262]
  3. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  4. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]