PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1316330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HD-ZIP
Protein Properties Length: 201aa    MW: 23244.1 Da    PI: 8.2622
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1316330.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97.2e-182481056
                     HHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox 10 eqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Lj2g3v1316330.1  2 EQVKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 48
                     8*********************************************9 PP

2HD-ZIP_I/II124.64.6e-40284991
      HD-ZIP_I/II  9 eqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91
                     eqvk+LE+sFe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr+yda+k++n++L++++++L++e+
  Lj2g3v1316330.1  2 EQVKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDLLKRQYDAIKSDNDALQAHNQKLQAEI 84
                     9*******************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000865.28E-14151No hitNo description
SMARTSM003898.7E-11154IPR001356Homeobox domain
PROSITE profilePS5007116.714150IPR001356Homeobox domain
SuperFamilySSF466892.05E-17259IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-19257IPR009057Homeodomain-like
PfamPF000463.6E-15248IPR001356Homeobox domain
PRINTSPR000316.5E-62130IPR000047Helix-turn-helix motif
PROSITE patternPS0002702548IPR017970Homeobox, conserved site
PRINTSPR000316.5E-63046IPR000047Helix-turn-helix motif
PfamPF021833.6E-175090IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MEQVKTLEKS FELGNKLEPE RKMQLARALG LQPRQIAIWF QNRRARWKTK QLEKDYDLLK  60
RQYDAIKSDN DALQAHNQKL QAEILALKNR EPTESINLNK ETEGSSSNRS ENSSDIKLDI  120
SRTPAIDSPL STHHHNSRTL FPPSARPAGS VAHQLFQSSS RPDLQCQKMD HMVKEESLSN  180
MFCGMDDQSG FWPWLEQQHF N
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14250RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.57540.0floral bud| flower| pod| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in leaves and flowers. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj2g3v1316330.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1404390.0BT140439.1 Lotus japonicus clone JCVI-FLLj-18M14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007157668.11e-128hypothetical protein PHAVU_002G088600g
SwissprotQ8LC031e-88ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLI3SIZ21e-147I3SIZ2_LOTJA; Uncharacterized protein
STRINGXP_007157668.11e-127(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.14e-84HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Chan RL
    Functional characterization of the homeodomain leucine zipper I transcription factor AtHB13 reveals a crucial role in Arabidopsis development.
    J. Exp. Bot., 2015. 66(19): p. 5929-43
    [PMID:26136262]
  3. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  4. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]