PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1277750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 157aa    MW: 18057.5 Da    PI: 7.1437
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1277750.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.8e-321771155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprl+WtpeLH+rF+ea +qLGG+ekAtPk+++++m+++gLtl+h+kSHLQkYRl
  Lj2g3v1277750.1 17 KPRLKWTPELHQRFIEATNQLGGAEKATPKNLMRVMGIPGLTLYHLKSHLQKYRL 71
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-301573IPR009057Homeodomain-like
SuperFamilySSF466891.47E-161672IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-221772IPR006447Myb domain, plants
PfamPF002497.7E-81970IPR001005SANT/Myb domain
PfamPF143791.1E-20117157IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MGLQNQSVHF VLSTDAKPRL KWTPELHQRF IEATNQLGGA EKATPKNLMR VMGIPGLTLY  60
HLKSHLQKYR LGKSQVLETC SDSKQEDDYD TETKSSDDHC SREISFGAQN QNTENLQIAE  120
ALQMQMEVQR KLYEQIEVQK HLQLRIEAQG KYLQSVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-231673158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-231673158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-231773157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-231773157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-231773157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-231773157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-231673158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-231673158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-231673158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-231673158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-231673158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-231673158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in phloem and/or cambium. {ECO:0000269|PubMed:15923329}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj2g3v1277750.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1494600.0BT149460.1 Lotus japonicus clone JCVI-FLLj-19J4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027361407.11e-98myb family transcription factor PHL8-like isoform X1
SwissprotF4I2741e-57PHL8_ARATH; Myb family transcription factor PHL8
SwissprotQ9SQQ91e-57PHL9_ARATH; Myb-related protein 2
TrEMBLI3T9R21e-111I3T9R2_LOTJA; Uncharacterized protein
STRINGXP_007157612.12e-93(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52183253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.15e-60G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]