PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1277260.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 447aa    MW: 48986.8 Da    PI: 7.3841
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1277260.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.72.4e-33169225259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      dDgynWrKYGqK+vkgsefprsYY+Ct+++Cpvkkkvers  d++v+ i+Y+geHnh+
  Lj2g3v1277260.2 169 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCPVKKKVERSL-DGHVTAIIYKGEHNHQ 225
                      8****************************************.***************8 PP

2WRKY107.85.5e-34337395159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+v+k+ver+++dpk+v++tYeg+Hnh+
  Lj2g3v1277260.2 337 LDDGYRWRKYGQKVVKGNPYPRSYYKCTTPGCNVRKHVERASTDPKAVITTYEGKHNHD 395
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.4E-30154227IPR003657WRKY domain
SuperFamilySSF1182903.66E-26166227IPR003657WRKY domain
SMARTSM007744.7E-37168226IPR003657WRKY domain
PROSITE profilePS5081123.87169227IPR003657WRKY domain
PfamPF031061.5E-25169225IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-37322397IPR003657WRKY domain
SuperFamilySSF1182907.32E-30329397IPR003657WRKY domain
PROSITE profilePS5081138.836332397IPR003657WRKY domain
SMARTSM007741.3E-39337396IPR003657WRKY domain
PfamPF031062.7E-26338395IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MNGDRPPWKE EAASGGRGPP PRPTITLPPR TDTLFSGGFS PGPMTLLSNL LADGDDCKSF  60
SQLLAGAMAS PAAAAHGGFS PGLFSPQVSF EMSHQQALAQ VSAQGSSNMH LQPENSLSRS  120
ALHTSNTTQH HLVPPSGEES HAAKTEPTDY SLSEQRFQSS SLNVDKPADD GYNWRKYGQK  180
HVKGSEFPRS YYKCTHPNCP VKKKVERSLD GHVTAIIYKG EHNHQRPHPN KRAKDAVISN  240
DNSNMQGNVD LTTYQGMSTN AMSKMDQESS QATAEHVSGT SDSEEVGDHE TEVDEKNVEP  300
EPKRRNTEVI PSEPASSHRT VTENRIIVQT TSEVDLLDDG YRWRKYGQKV VKGNPYPRSY  360
YKCTTPGCNV RKHVERASTD PKAVITTYEG KHNHDVPAAK TNSHTIANNS ASQLRSQNNN  420
HGFGNSGIGG NEQQPVARLR LKEEQIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-44169398878Probable WRKY transcription factor 4
2lex_A5e-44169398878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: In young, mature and senescent leaves. {ECO:0000269|PubMed:11722756}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Has a positive role in resistance to necrotrophic pathogens (e.g. Botrytis cinerea), but a negative effect on plant resistance to biotrophic pathogens (e.g. Pseudomonas syringae). {ECO:0000269|PubMed:18570649, ECO:0000269|PubMed:22219184}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj2g3v1277260.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By biotic and abiotic stresses such as pathogen infection (e.g. Botrytis cinerea and Pseudomonas syringae), salicylic acid (SA), jasmonic acid (JA), ethylene (ACC), liquid infiltration or spraying, and strongly during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:18570649}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0104960.0AP010496.1 Lotus japonicus genomic DNA, chromosome 2, clone: LjB15B24, BM1861, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027362352.10.0probable WRKY transcription factor 4 isoform X1
RefseqXP_027362353.10.0probable WRKY transcription factor 4 isoform X1
SwissprotQ9XI901e-139WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLA0A445LZ910.0A0A445LZ91_GLYSO; Putative WRKY transcription factor 4 isoform A
STRINGGLYMA01G06550.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-136WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]