PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1228810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family SBP
Protein Properties Length: 446aa    MW: 50215.9 Da    PI: 6.156
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1228810.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.63.2e-42168244177
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      +Cqv gC++dls+ k+yh+rhkvC+vhsk+p+v+v+g+eqrfCqqCsrfh l efD++krsCrrrLa+hnerrrk+q
  Lj2g3v1228810.1 168 VCQVFGCNKDLSSSKDYHKRHKVCDVHSKTPKVIVNGVEQRFCQQCSRFHLLAEFDDGKRSCRRRLAGHNERRRKPQ 244
                      6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-34163230IPR004333Transcription factor, SBP-box
PROSITE profilePS5114133.009166243IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.45E-40167248IPR004333Transcription factor, SBP-box
PfamPF031107.0E-32169242IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MESWSNVPEE KGYLFPDEVD FSLDAFMRST KTLVEWDNKP SCNFERDGFK SDREVVQSME  60
YVDLGFPLET SSCELDSNSS RRGNSSTHVI ALDSSLGDEE SESQHFSSLV ESKTHYSSLI  120
DLKLGRLADC KGASNEDVGE RFTLTSRHPT TALAKRARTS SLPAQAPVCQ VFGCNKDLSS  180
SKDYHKRHKV CDVHSKTPKV IVNGVEQRFC QQCSRFHLLA EFDDGKRSCR RRLAGHNERR  240
RKPQFDYMTG NKHTILQSYQ GTKFLGSSLQ NIPQFSFQDI FQSSILFSGK QDQIYHSEHV  300
KLEEEFCSPL LAAPVTLDQE LSSCALSLLS TPSSQNPSRH LTGNPLIFQG AFKDDQVSAS  360
PLRINSEEVI KNGSTTPSSD AGRTLQVQRD DICQPLESFN NKDCLSSEHG TSVDLFQLSS  420
NLQRVEQQRN SVLVKWEMEN YCFPTV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-29160242284squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj2g3v1228810.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003520128.10.0squamosa promoter-binding-like protein 6
RefseqXP_025981133.10.0squamosa promoter-binding-like protein 6
RefseqXP_025981134.10.0squamosa promoter-binding-like protein 6
RefseqXP_028203744.10.0squamosa promoter-binding-like protein 6 isoform X2
TrEMBLA0A445LN590.0A0A445LN59_GLYSO; Squamosa promoter-binding-like protein 6 isoform A
TrEMBLK7K7W50.0K7K7W5_SOYBN; Uncharacterized protein
STRINGGLYMA02G13371.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.14e-59SBP family protein