PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1079520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family ARR-B
Protein Properties Length: 255aa    MW: 28880.4 Da    PI: 8.5786
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1079520.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like80.22.4e-25201250151
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                      k+rl+Wt++LH++Fv av+qL G ++A+Pk+il+lm+v+gL+ +hv+SHLQ
  Lj2g3v1079520.1 201 KARLVWTTDLHSKFVAAVQQL-GFDRAVPKKILKLMNVEGLSKQHVASHLQ 250
                      68*******************.***************************** PP

2Response_reg70.29e-24251341109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      +l vd +++ +++l+++l+k +y +v++++++  ale+l++++  +Dl+++ ++ p+mdG+ llk++  e +++p+i++++h+++e++  ++ +
  Lj2g3v1079520.1  25 ILAVDGDQACLRVLENLLRKCNY-NVTTTTHSIMALEILRRNRnnFDLVITAVNKPDMDGFYLLKKLGLEMMDIPVIMLSGHNDKELVMSCVVY 117
                      7899*******************.***************888888**********************99999********************** PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+lsKp+ +ee+ +
  Lj2g3v1079520.1 118 GACDYLSKPIRMEEMKN 134
                      *************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521724.41E-3122146IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.2E-3522156No hitNo description
SMARTSM004481.3E-2323136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011037.19624140IPR001789Signal transduction response regulator, receiver domain
PfamPF000728.2E-2125134IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.11E-2126139No hitNo description
PROSITE profilePS5129411.76198255IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-24199250IPR009057Homeodomain-like
SuperFamilySSF466894.3E-15199251IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-21201251IPR006447Myb domain, plants
PfamPF002493.4E-7204250IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MDVTVRNPLV GDYVAGDHFP VGMRILAVDG DQACLRVLEN LLRKCNYNVT TTTHSIMALE  60
ILRRNRNNFD LVITAVNKPD MDGFYLLKKL GLEMMDIPVI MLSGHNDKEL VMSCVVYGAC  120
DYLSKPIRME EMKNIWQHVV RKKMIGSDQN QAANKDKTCN VAGEGSSYGC TVSENRMSQK  180
RKELSEDEKL KEDDEQSSRK KARLVWTTDL HSKFVAAVQQ LGFDRAVPKK ILKLMNVEGL  240
SKQHVASHLQ VQIHT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-16197250154ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj2g3v1079520.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0061311e-102AP006131.1 Lotus japonicus genomic DNA, chromosome 4, clone: LjT28E04, TM0229, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027368781.11e-96two-component response regulator ARR12-like
SwissprotB8B3I45e-79ORR22_ORYSI; Two-component response regulator ORR22
TrEMBLA0A1S2YP412e-91A0A1S2YP41_CICAR; Two-component response regulator
STRINGXP_004507711.13e-92(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.12e-80response regulator 12