PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1034880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HD-ZIP
Protein Properties Length: 305aa    MW: 34691.7 Da    PI: 6.8444
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1034880.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.5e-18107159456
                      -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  Lj2g3v1034880.1 107 KKRLSLEQVKALERSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 159
                      556899**********************************************9 PP

2HD-ZIP_I/II126.21.5e-40105197193
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      ekk+rls eqvk+LE+sFe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktk+lEk+ye+Lk++++a+k++n++L++++++L++el++
  Lj2g3v1034880.1 105 EKKKRLSLEQVKALERSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKHLEKEYEVLKKQFEAVKADNDNLKAQNHKLHAELQS 197
                      69***************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-1991162IPR009057Homeodomain-like
SuperFamilySSF466896.84E-1998162IPR009057Homeodomain-like
PROSITE profilePS5007117.086101161IPR001356Homeobox domain
SMARTSM003897.4E-18104165IPR001356Homeobox domain
CDDcd000864.07E-15106162No hitNo description
PfamPF000462.7E-15107159IPR001356Homeobox domain
PRINTSPR000311.1E-5132141IPR000047Helix-turn-helix motif
PROSITE patternPS000270136159IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5141157IPR000047Helix-turn-helix motif
PfamPF021832.0E-13161201IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MNDPYISSIF TIISSPFTMA FPPSHTFLFH NEDHHNLLRS TSTSLNAFPS FPPQQPHFQG  60
GGGGAAFMMK RSVSFSGLEM NNNKCDEVLH GGDDDLSDDG SQLGEKKKRL SLEQVKALER  120
SFELGNKLEP ERKMQLAKAL GLQPRQIAIW FQNRRARWKT KHLEKEYEVL KKQFEAVKAD  180
NDNLKAQNHK LHAELQSLKN RECCETGTIS FKKENEGSWS NGSDNSSDIN LEPSRTPMMN  240
SPAVSSDQNG KNLLPTSLKP TSITQLLQCS SRTDLQDESF SNMFHSIDDQ QQNFWPWPEQ  300
HHNFH
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.84400.0floral bud| flower| pod| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in flowers, and in the cortex of the root and the stem. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj2g3v1034880.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1461760.0BT146176.1 Lotus japonicus clone JCVI-FLLj-12B12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027359248.11e-158homeobox-leucine zipper protein ATHB-20-like
SwissprotQ004661e-71HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLI3T0C80.0I3T0C8_LOTJA; Uncharacterized protein
STRINGXP_007151217.11e-148(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01220.13e-55homeobox protein 20