PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v0636680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 363aa    MW: 40567.6 Da    PI: 8.3114
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v0636680.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.25.7e-31235288255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+L l+hvkSHLQ+YR+
  Lj2g3v0636680.1 235 PRMRWTSSLHNRFVHAVELLGGHERATPKSVLELMDVKDLKLAHVKSHLQMYRT 288
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.02E-14232289IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-27233289IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-22235288IPR006447Myb domain, plants
PfamPF002495.4E-6236287IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MPQNLIPDLS LHISLPNSAP SSICTNERDD DSAFDIWRSS AEEEGEYGFK SHSDGSIKGS  60
SNIELSLGNP TSTTPSEAES PWRRSRNFVR ATQERQTTTN HGEVSEGVRR VITTPFNGIP  120
FYNSNNSSTE RVSSLYAPLP LPYPSCSPNN DATVGGVSVT PISRFNGITM ENLRPNQQFQ  180
YLNHHHHHQQ QLLHNHHQNQ QQFGTNGVSD FANGFMRSRM FNTPKLQSKR NMRAPRMRWT  240
SSLHNRFVHA VELLGGHERA TPKSVLELMD VKDLKLAHVK SHLQMYRTVK NTDKPAASSD  300
GDEDFISLTP PPINQSKNNY LPNQRGPLNA PQSHDDMAHT SSNLWANSSS SRRTNTSDFP  360
GSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-16236290357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16236290357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16236290357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16236290357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.205320.0pod
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj2g3v0636680.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027359217.11e-127transcription repressor KAN1-like isoform X2
TrEMBLA0A151RF881e-119A0A151RF88_CAJCA; Putative Myb family transcription factor At1g14600 family
STRINGGLYMA07G12070.11e-115(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.16e-44G2-like family protein