PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v4998480.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 324aa    MW: 36150.3 Da    PI: 5.5745
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v4998480.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.38.2e-34206260155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr+rWtpeLHe+Fveav++LGGsekAtPk +l+ mkv+gLt++hvkSHLQkYR+
  Lj1g3v4998480.2 206 KPRMRWTPELHEAFVEAVNHLGGSEKATPKGVLNRMKVEGLTIYHVKSHLQKYRT 260
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.812203263IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-31204262IPR009057Homeodomain-like
SuperFamilySSF466892.33E-17204260IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-25206260IPR006447Myb domain, plants
PfamPF002496.1E-10208259IPR001005SANT/Myb domain
PfamPF143799.9E-15293324IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MSSLPALHSP LENKYMKPPD SFLARDLAAN PASKQATSSN MTRSGEQMFS SPAECPGDIR  60
FHAVSQHDRQ YRDSPFISPT LGGNVTSEIH STALISHPQE NDISWGPDPF QDILSFPDNV  120
LVQNDQVENG ACYMNDDNVK RSDFGEWVDQ LMTIDDSQHP NWSQLLGDDN VAEPKPKAIQ  180
VSPLQQLSSG EVSGLSNSAS TASQSKPRMR WTPELHEAFV EAVNHLGGSE KATPKGVLNR  240
MKVEGLTIYH VKSHLQKYRT ARYKPESSEG TSEAKITSID EMKSLDLKTS KGITEALRLQ  300
MELQKRLHEQ LEIQRNLQIQ IENQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-31206264260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-31206264260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-31206264260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-31206264260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-31206264260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-31206264260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-31206264260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-31206264260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.150780.0cell culture| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in shoots and roots. {ECO:0000269|PubMed:20838596}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as central integrator of phosphate starvation responses (PubMed:20838596). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). {ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:23788639}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v4998480.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not up-regulated by Pi starvation. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001350645.11e-180MYB-CC domain-containing transcription factor PHR10
RefseqXP_006577307.11e-180MYB-CC domain-containing transcription factor PHR10 isoform X2
RefseqXP_025983474.11e-180MYB-CC domain-containing transcription factor PHR10 isoform X2
RefseqXP_028226743.11e-180protein PHR1-LIKE 1-like isoform X2
RefseqXP_028226744.11e-180protein PHR1-LIKE 1-like isoform X2
SwissprotQ8GUN55e-85PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A445LH291e-179A0A445LH29_GLYSO; Protein PHR1-LIKE 1 isoform B
TrEMBLI1JRR71e-179I1JRR7_SOYBN; PHR2
STRINGGLYMA03G41040.31e-179(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.22e-87G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Bonnot C, et al.
    A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana.
    New Phytol., 2016. 209(1): p. 161-76
    [PMID:26243630]
  4. Aleksza D,Horváth GV,Sándor G,Szabados L
    Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation.
    Plant Physiol., 2017. 175(1): p. 555-567
    [PMID:28765275]