PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v4915280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HB-other
Protein Properties Length: 1010aa    MW: 112714 Da    PI: 9.541
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v4915280.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox18.43.6e-0669125157
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      +r+R  ++++ ++ ++++F  +  +s++e +e+++  g+t +qV+ +F  +R + ++
  Lj1g3v4915280.1  69 KRPRDLLNPKAVNYMQSVFSIKDAISKKESREISAMFGVTVTQVRDFFTSQRSRVRR 125
                      799**************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.94466126IPR001356Homeobox domain
SMARTSM003894.8E-468130IPR001356Homeobox domain
CDDcd000864.60E-469125No hitNo description
Gene3DG3DSA:1.10.10.601.0E-569132IPR009057Homeodomain-like
SuperFamilySSF466892.44E-669131IPR009057Homeodomain-like
Gene3DG3DSA:1.20.930.103.9E-6221314IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476763.14E-5223313IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1010 aa     Download sequence    Send to blast
MDLWNDDFSQ LEIGTTVDSL QSFLASQREL FQSQIDQFQH IVVTQCNLTG VNPLSQEMAA  60
GALSIKIGKR PRDLLNPKAV NYMQSVFSIK DAISKKESRE ISAMFGVTVT QVRDFFTSQR  120
SRVRRLVQLS KQRALRSSSC EEPHGEQINS DHVRPINPPL LDTAGSTNAE ETSCSTQEAA  180
LSDLDDSDKH FVENIFSLIQ KEETFSGQEK LMEWILTIQN FSVLSWFLTK GGAMSLATWL  240
NKAAVEEQTS VLLLILKVLC HLPLHKALPA HISAILQSVN GLRFYRTQDI SNRARVLLSK  300
WSKLLARNQA LKKPNGVKTS GEKQMMLSHR QASESWHSNI DLPEDILAPS NEYSDNFRKL  360
EPLQALKLLP PSDDSHKKPT LGVSSSHARE RRKVQLVEQP GQKSVSRSPQ VARVAPVSQS  420
RPMSADDIQK AKLRASFMQS KYGKTGSSKE SKEPKIVSLN KPQTNQVSIA VSSSKVHVPP  480
KIEEDKKPPV LPSKNTIRLD ASYSKLKMDL KESPWEKCKR VQIPWKTPAE VKLNDTWKVG  540
NGENSKEVDV QTNRHRREKD TIYQTIKEMP SNPKEPWDLE MDYDDTLTPE IPIEQLPDGD  600
SAEVVATPND VATHAVQSVA STSSTGNAAP AEPDLELLAV LLKNPELVFA LTSGQAGNIP  660
NEETMKLLDM IKRSSVNLGL GENTNGNLSN NAKSPETVEV SLPSPTPSND PRTNGWSTEA  720
SKNPFTRRGM APDRIIQNSA AVATTNLLRQ QSTVVVPPSN HLTSSAVSPY SLPHAANFIP  780
EKQPAPTLSS VHVQAQSSDF GLTMKKNITT ANAASVNLQG THSHLELRSD TRSYVKPVAN  840
LSVREGLSNS LPQSFMLTSR TPSHPATQQQ RHHPHLLHQA HFTEPSYRNP VQSYPPQIEK  900
PGPSDLWRER QDVSSSYHSQ RIHNNYNTLI GESMQSGSYD RNNDGSEGFE TWSPENSPTR  960
NPRYVPGRNF PESRMNNVRN PRHEWSRQRG SSGNWGPDRH GNKRWNDQRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003553647.10.0PREDICTED: homeobox protein LUMINIDEPENDENS-like
SwissprotQ387961e-159LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLI1NB350.0I1NB35_SOYBN; Uncharacterized protein
STRINGGLYMA19G39620.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-148HB-other family protein