PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v4752710.1
Common NameCBF-A22
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YA
Protein Properties Length: 328aa    MW: 35629.1 Da    PI: 9.7362
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v4752710.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA96.43.1e-30161216258
        CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       p+YVNaKQy++I++RRq+Rak+  ++k+ +k rkpylheSRh hAlrRpRg+gGrF
  Lj1g3v4752710.1 161 GPIYVNAKQYHGIIRRRQSRAKAVLDRKM-TKRRKPYLHESRHLHALRRPRGCGGRF 216
                      69**************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.5E-34158219IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.654159219IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.6E-26162216IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.4E-23162184IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.4E-23193216IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MAMQTANLIE HEGIAHNFVG QLSSATSAPW WSAFGSQAVY GESCGQMKPF SLEPPISVDQ  60
LAAGKQSARG AEQVLAKGHT TQFTIFPDDC KVLGNAQKPQ TTISLQSSPT DTHSRFELGF  120
SQPMICAKYP YTDQFYGLFS TYGPQISGRI MLPLNLTTDE GPIYVNAKQY HGIIRRRQSR  180
AKAVLDRKMT KRRKPYLHES RHLHALRRPR GCGGRFLNTK VSANGNGKTG RDVKKTGGEQ  240
LQSSGSQGSD VFQSEVGTLN SSKETNGSSP NVSGLEVTSM YSRGGFDTFS FNHLGSSVYP  300
LADMVDCGRG IMPTKWVAAG GNSCNLNT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A7e-18160220262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
4g91_A7e-18160217260HAPB protein
4g92_A7e-18160217260HAPB protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174193RRRQSRAKAVLDRKMTKRRK
2174194RRRQSRAKAVLDRKMTKRRKP
3175194RRQSRAKAVLDRKMTKRRKP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.174430.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3786280.0AB378628.1 Lotus japonicus CBF-A22 mRNA for transcription factor CCAAT, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007162983.10.0hypothetical protein PHAVU_001G196800g
RefseqXP_007162985.10.0hypothetical protein PHAVU_001G196800g
RefseqXP_007162984.10.0hypothetical protein PHAVU_001G196800g
RefseqXP_007162986.10.0hypothetical protein PHAVU_001G196800g
TrEMBLB3IX280.0B3IX28_LOTJA; Transcription factor CCAAT
STRINGGLYMA03G36140.40.0(Glycine max)
STRINGGLYMA19G38800.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37943464
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.29e-62nuclear factor Y, subunit A10
Publications ? help Back to Top
  1. Asamizu E,Shimoda Y,Kouchi H,Tabata S,Sato S
    A positive regulatory role for LjERF1 in the nodulation process is revealed by systematic analysis of nodule-associated transcription factors of Lotus japonicus.
    Plant Physiol., 2008. 147(4): p. 2030-40
    [PMID:18567832]