PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v4752480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 677aa    MW: 74178.2 Da    PI: 6.9085
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v4752480.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-093824191954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Lj1g3v4752480.1 382 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 419
                      554459******************************88 PP

2BELL119.51.5e-38246317172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      erqe+q+kkakL+s+l+eV++rY+qy++q+++v+ssFe++ag+ sa+ Yt+lAl++iS++FrcLkdai++qi
  Lj1g3v4752480.1 246 ERQEIQMKKAKLISMLDEVEQRYRQYHNQMEIVVSSFEQAAGISSARTYTALALQTISKQFRCLKDAITGQI 317
                      79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-59180315IPR006563POX domain
PfamPF075262.3E-46185314IPR006563POX domain
PROSITE profilePS5007112.195360423IPR001356Homeobox domain
CDDcd000861.13E-11363423No hitNo description
SMARTSM003895.3E-9363427IPR001356Homeobox domain
SuperFamilySSF466895.99E-17364430IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.6E-29366430IPR009057Homeodomain-like
PfamPF059202.8E-18380419IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MATYYHGNSE IQSAGGGADG LQTLVLMNPG SYIQYSDNTP QQPPQSHTAC NLVFLNAASA  60
ASNNNNNSFS PHAPPTHGQQ FVGIPLQASS SQDLNHHHQQ HHHSVDVPSL HGFMPRMQYN  120
LWNTIDGNPA ARDTPRAQQG LSLSLSPQQV QMGSFREGQA QALSGGSPSS ASGVTHNGAS  180
GVQSVLLSSK YLRAAHELLE EVANVNTELA KKSGGPNNRL IGESSVAGSG GGEGSEKRSA  240
ELSTAERQEI QMKKAKLISM LDEVEQRYRQ YHNQMEIVVS SFEQAAGISS ARTYTALALQ  300
TISKQFRCLK DAITGQIRAV NKNLGEEDCF GGKMEGSRLK YVDHHLRQQR ALQQLGMIQH  360
NAWRPQRGLP ERSVSVLRAW LFEHFLHPYP KDSDKHMLAK QTGLTRSQVS NWFINARVRL  420
WKPMVEEMYM EEMKEHENNG SEDKSSKSNE DSSKKMAAAS QEKGPISETE AGSFNSKGQD  480
NPAVSVSRPP TSPMGGNVRN QSGFSFMGSS ELEGITQGSP KKQRNQEMMH STNSVPSIDM  540
DVKSNDANNE HLSMKFGDER QQGRDGYSFM GNQTNFMGGF GQYPIGDIGR FDAEQFTQRF  600
SGNGVSLTLG LDSLPGTHQT FLPNQNIQLG RGLDISEPNE FDAMNTSSPH SSAAAYETIS  660
MQNPKRFAAQ LLPDFVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16369427563Homeobox protein Meis2
3k2a_B3e-16369427563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.203460.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0104470.0AP010447.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjT41E03, TM1391, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007162972.10.0hypothetical protein PHAVU_001G195800g
SwissprotQ9SJ561e-174BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLV7D1A00.0V7D1A0_PHAVU; Uncharacterized protein
STRINGGLYMA03G36070.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16273492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-148BEL1-like homeodomain 1