PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v4699740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GRF
Protein Properties Length: 383aa    MW: 41881.4 Da    PI: 8.2606
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v4699740.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC81.76.7e-26140183144
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      d+epgrCrRtDGKkWRCsr+v++g+k+CErH+hrg++rsrk++e
  Lj1g3v4699740.1 140 DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHMHRGKNRSRKPVE 183
                      79***************************************987 PP

2QLQ514.5e-1871107137
              QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      s+F+ +Q+q+L+ Q+l+++y++a+  vPpeLlq+i+k
  Lj1g3v4699740.1  71 SYFSLSQWQELELQALIFRYMLAGTSVPPELLQPIKK 107
                      78*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.4E-1071107IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.7E-1372105IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.08372107IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.463140184IPR014977WRC domain
PfamPF088798.4E-22141183IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MDFHLKQWRN QHESEEQQHS SKMPKLLPEP PSTASALPLF VPEPNSKVSN LSDSSTFPST  60
TTTNRFPRMA SYFSLSQWQE LELQALIFRY MLAGTSVPPE LLQPIKKSLL HSPSFFLHHP  120
LQHYQPTLLQ SGYWGRAAMD PEPGRCRRTD GKKWRCSRDV VAGQKYCERH MHRGKNRSRK  180
PVELPTPTSA GGGAGVGGGS FCASSSTSSP PLVTASMKSP FDLLHLNERS SGTKKEDKSL  240
FESQDHVSGD GRSGGHMLRH FFDDWPRSLQ DSDNNNAENN TGRVNSSTCL SISMPGNTSS  300
SDVSLKLSTG YGGSEDPGTR SENMGMEAEQ VQLNWAGGWA SSGNHSMGGP LAEALRSSTS  360
TSSPTSVLHQ LHRGSGSETS FIS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1968562e-53AC196856.3 Medicago truncatula chromosome 7 BAC clone mth2-33h9, complete sequence.
GenBankAC1709882e-53AC170988.5 Medicago truncatula chromosome 7 BAC clone mth2-53m12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007162865.10.0hypothetical protein PHAVU_001G187500g
SwissprotQ8L8A71e-100GRF4_ARATH; Growth-regulating factor 4
TrEMBLV7CXL50.0V7CXL5_PHAVU; Uncharacterized protein
STRINGGLYMA19G37740.11e-179(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF78953242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.12e-95growth-regulating factor 4