PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v4515910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 486aa    MW: 53257.8 Da    PI: 5.4342
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v4515910.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.61.7e-34261315155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr+rWtpeLHe+Fveav+qLGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  Lj1g3v4515910.1 261 KPRMRWTPELHEAFVEAVNQLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 315
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.061258318IPR017930Myb domain
SuperFamilySSF466893.94E-18259315IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-32260317IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-25261315IPR006447Myb domain, plants
PfamPF002494.6E-10263314IPR001005SANT/Myb domain
PfamPF143793.0E-26346393IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MEARPALSIE RSSPMQLNNI GMSGALPSSL PVLPMPLEET YPKLSDSHPA FVEKELNTKP  60
FIHSSHLSSS GAVGHMFSSS PGYSTDLHHP SLSPHEKHSR NVHFMSQSLS NGAPLRSYAS  120
NNGPIPSTTS THYSNGNSAS WHTDSLPSFL DFSANTSVDT SQVESSACDI MAIEEYSKRN  180
DWHEWADQLI SDDDTLTSNW NDLLADNIQD LEPKMVDRVS KPSSQYPVGN QSQAIPQLPA  240
SSGEHHAVTA PSSSANSAPA KPRMRWTPEL HEAFVEAVNQ LGGSERATPK GVLKLMKVEG  300
LTIYHVKSHL QKYRTARYRP ESSEGATDRK LSPIEDMSSL DLKTGIEITE ALRMQMEVQK  360
RLHEQLEIQR NLQLRIEEQG RYLQMIFEKQ CKSGVEPFKA SSSAIESVSG VSSDALKDSP  420
DKTELEASKA NHCRSDQATN GSTVVDGSAQ EAGEKQDAPE SQASENPKQI ADEDGAQAPK  480
RARTDE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-32260319160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-32260319160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-32260319160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-32260319160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-32260319160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-32260319160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-32260319160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-32260319160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.7551e-168floral bud
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v4515910.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003625354.10.0protein PHOSPHATE STARVATION RESPONSE 1
TrEMBLG7KXD80.0G7KXD8_MEDTR; Myb-like transcription factor family protein
TrEMBLI3S4T90.0I3S4T9_MEDTR; Uncharacterized protein
STRINGAES815720.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.11e-101phosphate starvation response 1