PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v4317520.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 255aa    MW: 28332.8 Da    PI: 9.1491
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v4317520.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.42.9e-3281135155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r+rWt++LHe+Fve+v++LGG++kAtPk+il++m+ +gLt++h+kSHLQkYR 
  Lj1g3v4317520.2  81 KTRIRWTKDLHEKFVECVNRLGGADKATPKAILKMMDSDGLTIYHIKSHLQKYRN 135
                      68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.08278138IPR017930Myb domain
SuperFamilySSF466891.79E-1779135IPR009057Homeodomain-like
TIGRFAMsTIGR015577.6E-2481136IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-2881136IPR009057Homeodomain-like
PfamPF002499.2E-1085134IPR001005SANT/Myb domain
PfamPF143793.5E-18166212IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MVKSQLNSNQ DNKISCGDFP SSKFVPIEPQ KLLYDGVTSV SWSSSSLNKG NQDCMAVSGS  60
SGSVSTAFGN SSSNGSVILS KTRIRWTKDL HEKFVECVNR LGGADKATPK AILKMMDSDG  120
LTIYHIKSHL QKYRNAKFMP ESAQGISNKR VHTEDVHHLD FKTGLQIREA LQLQLDTQRR  180
LHEQLELQRA LQLRIEEQGK QLKKMFDQQQ RTSDNLLNTP DIANDATAIS HKDVEGSVSE  240
GASDSFFSSK STKIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-2381138259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-2381138259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-2381138158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-2381138158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-2381138158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-2381138158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-2381138259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-2381138259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-2381138259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-2381138259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-2381138259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-2381138259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.136342e-35cell culture| protoplast
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v4317520.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0096611e-114AP009661.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjT38A19, TM0221, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027353137.11e-117myb family transcription factor PHL5-like
SwissprotQ0WVU35e-69PHL5_ARATH; Myb family transcription factor PHL5
TrEMBLA0A1S2XRU81e-115A0A1S2XRU8_CICAR; protein PHOSPHATE STARVATION RESPONSE 3-like
TrEMBLV7CVV71e-114V7CVV7_PHAVU; Uncharacterized protein
STRINGXP_004493572.11e-115(Cicer arietinum)
STRINGXP_007162313.11e-115(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.17e-54G2-like family protein