PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v4317520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 361aa    MW: 40145.8 Da    PI: 6.7382
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v4317520.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65.1e-32187241155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r+rWt++LHe+Fve+v++LGG++kAtPk+il++m+ +gLt++h+kSHLQkYR 
  Lj1g3v4317520.1 187 KTRIRWTKDLHEKFVECVNRLGGADKATPKAILKMMDSDGLTIYHIKSHLQKYRN 241
                      68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.082184244IPR017930Myb domain
SuperFamilySSF466893.23E-17185241IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-23187242IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.4E-28187242IPR009057Homeodomain-like
PfamPF002491.6E-9191240IPR001005SANT/Myb domain
PfamPF143795.9E-18272318IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MNENKIDCVG LIQQSHGLTG DFDSEFGNHS NTIMSRFESP ASAFYAAENC MGFSEYDYQV  60
GNTNQSLSSQ LNKVHDLEFP LYQSPRLNLF MNSANQPDPL SNTLQAMVKS QLNSNQDNKI  120
SCGDFPSSKF VPIEPQKLLY DGVTSVSWSS SSLNKGNQDC MAVSGSSGSV STAFGNSSSN  180
GSVILSKTRI RWTKDLHEKF VECVNRLGGA DKATPKAILK MMDSDGLTIY HIKSHLQKYR  240
NAKFMPESAQ GISNKRVHTE DVHHLDFKTG LQIREALQLQ LDTQRRLHEQ LELQRALQLR  300
IEEQGKQLKK MFDQQQRTSD NLLNTPDIAN DATAISHKDV EGSVSEGASD SFFSSKSTKI  360
T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-23187244259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-23187244259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-23187244158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-23187244158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-23187244158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-23187244158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-23187244259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-23187244259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-23187244259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-23187244259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-23187244259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-23187244259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.136342e-35cell culture| protoplast
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v4317520.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0096610.0AP009661.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjT38A19, TM0221, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027353137.11e-171myb family transcription factor PHL5-like
TrEMBLV7CVV71e-167V7CVV7_PHAVU; Uncharacterized protein
STRINGXP_007162313.11e-168(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.16e-53G2-like family protein