PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v4317480.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 315aa    MW: 35850.6 Da    PI: 7.8996
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v4317480.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like751e-23182236155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k r+rW+++LHe F+  v++LGG+ekA Pk+ile+mk + L+++h+kSHLQk R+
  Lj1g3v4317480.2 182 KRRIRWSKDLHEPFMMIVNSLGGPEKAKPKAILEMMKSDLLSISHIKSHLQKCRS 236
                      68**************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.55E-11180236IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.0E-21181237IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-18182236IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MMNGTPCWEV VGSELLSFEP IKSPYNFVTT TASPVFGASA KSLVSFQAQE HDHGQNQNID  60
VPGWCYEFPS TPMMIFQGSE DNFTNVTSTV QDRPSSQFTS SLHSVAESFI SSSEDSHSCS  120
ENYGKIEPGM PLYDHLLQEQ LRNNAATDKS PLEISFQRNQ LGSCTKQEKQ APGLSRRSPT  180
SKRRIRWSKD LHEPFMMIVN SLGGPEKAKP KAILEMMKSD LLSISHIKSH LQKCRSTSYM  240
HKALQERSEG RHRTDGVTEL QVQISHMQIE ESRKLQLEVR RSICLQLEMQ QNLKMLIEGQ  300
RKELKVMLDR QKERT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-15182239259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-15182239259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-15182239259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-15182239259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-15182239259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-15182239259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-15182239259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-15182239259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v4317480.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0096610.0AP009661.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjT38A19, TM0221, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027351075.11e-121protein PHOSPHATE STARVATION RESPONSE 1-like
TrEMBLA0A371G3Q21e-122A0A371G3Q2_MUCPR; Myb family transcription factor PHL5 (Fragment)
STRINGGLYMA03G29935.11e-112(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144901016
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.12e-31G2-like family protein