PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v4093230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 306aa    MW: 33604.4 Da    PI: 6.9478
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v4093230.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.71.7e-30106159155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Lj1g3v4093230.1 106 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 159
                      59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.96E-20103163IPR009057Homeodomain-like
PROSITE profilePS5129411.059103162IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-30105164IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-24107159IPR006447Myb domain, plants
PfamPF002491.2E-7109158IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MREDDSNWFV RWEEELPSPE ELMPLSQTLI TPDLAMAFDI RNSLTATINN NPQQQHQQQQ  60
QLQLQQQQQP PLSSNPSSLP SSADFADSGE LGSGNGGEEP ARTLKRPRLV WTPQLHKRFV  120
DAVAHLGIKN AVPKTIMQLM SVDGLTRENV ASHLQKYRLY LKRMQGISAG GPGGGGAGPA  180
GSADPTDHLF ASSPVPAHFL HPTARPNSDH FLPFVPVPAA LHHHHQQQQQ QHHLAAAAQY  240
HRPVGHFGSP PNGHFENPFL SRQQQLHRMG APVHNNPALS SYVEDMESAN ASGGRKVLTL  300
FPTGDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A2e-31106162157Transcription factor LUX
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, stems, petioles, filaments, stigma, pedicels, sepals, anthers, petals, and siliques. {ECO:0000269|PubMed:20331973}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway. {ECO:0000269|PubMed:20331973}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v4093230.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, salt and abscisic acid (ABA). Down-regulated by cold. {ECO:0000269|PubMed:20331973}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007162050.11e-140hypothetical protein PHAVU_001G119500g
SwissprotO222103e-63MYBC1_ARATH; Transcription factor MYBC1
TrEMBLV7CV761e-139V7CV76_PHAVU; Uncharacterized protein
STRINGXP_007162050.11e-140(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85423045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.19e-80G2-like family protein
Publications ? help Back to Top
  1. Sardesai N,Laluk K,Mengiste T,Gelvin S
    The Arabidopsis Myb transcription factor MTF1 is a unidirectional regulator of susceptibility to Agrobacterium.
    Plant Signal Behav, 2018.
    [PMID:24785741]