PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v4048450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 283aa    MW: 31079.4 Da    PI: 5.1006
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v4048450.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.72.7e-3352106155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+rlrWt++LH+rFv+a++qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Lj1g3v4048450.1  52 KQRLRWTSDLHDRFVDAITQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRL 106
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.00849109IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-3251107IPR009057Homeodomain-like
SuperFamilySSF466894.12E-1752106IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-2652107IPR006447Myb domain, plants
PfamPF002491.5E-754105IPR001005SANT/Myb domain
PfamPF143796.7E-24139184IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MYQEKKFSPT TMVPQKSQGG GGGAEQLANV GVLALGGSAA VRSPTPAGGN GKQRLRWTSD  60
LHDRFVDAIT QLGGPDRATP KGVLRVMGVP GLTIYHVKSH LQKYRLAKYL PDSLVDDSKE  120
EKRTSGDSTS GVDSSPGLQI NDALRMQMEV QKRLHEQLEV QKQLQMRIEA QGKYLQKIIE  180
EQQKLGSTLT VSEMLPLSHD KQNHPQSEPS GSSDALAGTL SPHKRRRIDD GSNDDLAASQ  240
DPRETAQKND CNVGQLDPNL YEDDAGFGYD LERENDEDEE SEQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-2351109159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-2351109159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-2351109159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-2351109159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-2351109159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-2351109159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-2351109159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-2351109159Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1223227KRRRI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.108590.0cell culture| pod| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v4048450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020219241.11e-162myb family transcription factor PHL7 isoform X2
TrEMBLA0A1S2XR951e-160A0A1S2XR95_CICAR; myb family transcription factor PHL7-like isoform X1
STRINGXP_004493285.11e-161(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130132330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.13e-66G2-like family protein