PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v3964530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GATA
Protein Properties Length: 274aa    MW: 30622.8 Da    PI: 7.6974
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v3964530.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA52.19e-17200234135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C++C +  Tp+WR gp g+ktLCnaCG++y++ +l
  Lj1g3v3964530.1 200 CTHCLSQRTPQWRAGPLGPKTLCNACGVRYKSGRL 234
                      *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004017.9E-15194244IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.09E-14195258No hitNo description
Gene3DG3DSA:3.30.50.101.5E-13198235IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.095198230IPR000679Zinc finger, GATA-type
CDDcd002024.85E-12199246No hitNo description
PROSITE patternPS003440200225IPR000679Zinc finger, GATA-type
PfamPF003201.4E-14200234IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MTMDVCQNVS VPSECQKQEQ QQALATNCSI DDLFSAQNME VDNGLEWLSE FVEDCFSTPS  60
GCVLVPASVQ TASTSSKSKP LGTTVQKPLE SESPLQKNSV PGKARSKRKR LSAPRTKDPL  120
SMWSHHLNPQ NEAFGPDPPL LKQDYWLADS ELIVKKEEQE VTTKEEQEVV VVVKKEIIVK  180
EEFEDGEVSN NGQNPMPRRC THCLSQRTPQ WRAGPLGPKT LCNACGVRYK SGRLHPEYRP  240
AKSPTFVSFL HSNSHKKVME MRMAPLSSIP ISKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.253920.0cell culture
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v3964530.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0935012e-80BT093501.1 Soybean clone JCVI-FLGm-14K19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027352729.11e-142GATA transcription factor 5-like
TrEMBLA0A371EV451e-133A0A371EV45_MUCPR; GATA transcription factor 9 (Fragment)
STRINGXP_007161927.11e-125(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84872444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.11e-35GATA transcription factor 9