PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v3964520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GATA
Protein Properties Length: 153aa    MW: 17520.1 Da    PI: 8.3398
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v3964520.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA53.43.6e-1779113135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C++C +  Tp+WR gp g+ktLCnaCG++y++ +l
  Lj1g3v3964520.1  79 CTHCLSQRTPQWRAGPLGPKTLCNACGVRYKSGRL 113
                      *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004017.9E-1573123IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.33E-1574137No hitNo description
PROSITE profilePS5011411.09577109IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.6E-1477114IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.76E-1278125No hitNo description
PfamPF003205.5E-1579113IPR000679Zinc finger, GATA-type
PROSITE patternPS00344079104IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MWSHHLNPQN EAFGPDPPLL KQDYWLADSE LIVKKEEQEV TTKEEQEVVV VVKKEIIVKE  60
EFEDGEVSNN GQNPMPRRCT HCLSQRTPQW RAGPLGPKTL CNACGVRYKS GRLHPEYRPA  120
KSPTFVSFLH SNSHKKVMEM RMAPLSSIPI SKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.253920.0cell culture
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v3964520.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0935011e-80BT093501.1 Soybean clone JCVI-FLGm-14K19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027352729.11e-80GATA transcription factor 5-like
SwissprotO826321e-34GATA9_ARATH; GATA transcription factor 9
TrEMBLA0A371EV457e-75A0A371EV45_MUCPR; GATA transcription factor 9 (Fragment)
STRINGXP_007161927.11e-73(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84872444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.19e-36GATA transcription factor 4
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]