PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v2982410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 519aa    MW: 56571.7 Da    PI: 6.9518
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v2982410.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.27.3e-33223280260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      dDgynWrKYGqK+vkgs++prsYY+Ct+ +Cpvkkkver+  d++++ei+Y+g+Hnhek
  Lj1g3v2982410.1 223 DDGYNWRKYGQKQVKGSDYPRSYYKCTHLNCPVKKKVERAP-DGRITEIIYKGQHNHEK 280
                      8****************************************.***************85 PP

2WRKY105.52.8e-33403461159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k+v++tYeg+Hnh+
  Lj1g3v2982410.1 403 LDDGYRWRKYGQKVVKGNPHPRSYYKCTSAGCNVRKHVERASTDAKAVITTYEGKHNHD 461
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.0E-29215282IPR003657WRKY domain
SuperFamilySSF1182909.29E-26221281IPR003657WRKY domain
SMARTSM007746.1E-35222280IPR003657WRKY domain
PfamPF031061.2E-25223279IPR003657WRKY domain
PROSITE profilePS5081124.248223281IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.5E-37388463IPR003657WRKY domain
SuperFamilySSF1182904.71E-29395463IPR003657WRKY domain
PROSITE profilePS5081138.836398463IPR003657WRKY domain
SMARTSM007745.2E-39403462IPR003657WRKY domain
PfamPF031067.1E-26404461IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:1900150Biological Processregulation of defense response to fungus
GO:1900425Biological Processnegative regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 519 aa     Download sequence    Send to blast
MSTTTSNADA VTAPPDPPTT RPTISLPPRP SLESFFAAGA VSPGPMTLVS SFFATDDCRS  60
FSQLLAGAMS PLAFPAAADK DDDGAHKGIG FKQSRPMNLV IARSPMFTIP PGLSPSGFLN  120
SPGFFSPQSP FGMSHQQALA QVTAQAVFAQ SQMQMQADYQ PSAETTSTEA PVEQQSFTLN  180
EASEQQGVAS VSEPRNAQLE TSELPPADKK YQPSSLVIDK PGDDGYNWRK YGQKQVKGSD  240
YPRSYYKCTH LNCPVKKKVE RAPDGRITEI IYKGQHNHEK PQSNKRTRDN SESNGTANIQ  300
PKSESNSQGL FGNVNKVSES APDCSVPESD QISNQGAPRN LGSSESADVG DVDNREEGDD  360
IEPNPKRRST DLVVSEAPAA PMSQKTVTEP KIIVQTRSEV DLLDDGYRWR KYGQKVVKGN  420
PHPRSYYKCT SAGCNVRKHV ERASTDAKAV ITTYEGKHNH DVPAARNSSH NTASSNSMQP  480
KPQNMGPEKH PLLKDMDFGN NNNDQRPVHL RLKEEQIIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-39223464878Probable WRKY transcription factor 4
2lex_A2e-39223464878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.89941e-148floral bud| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: In young, mature and senescent leaves. {ECO:0000269|PubMed:11722756}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Has a positive role in resistance to necrotrophic pathogens (e.g. Botrytis cinerea), but a negative effect on plant resistance to biotrophic pathogens (e.g. Pseudomonas syringae). {ECO:0000269|PubMed:18570649, ECO:0000269|PubMed:22219184}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v2982410.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By biotic and abiotic stresses such as pathogen infection (e.g. Botrytis cinerea and Pseudomonas syringae), salicylic acid (SA), jasmonic acid (JA), ethylene (ACC), liquid infiltration or spraying, and strongly during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:18570649}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020218833.10.0probable WRKY transcription factor 4
SwissprotQ9XI901e-145WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLA0A1S3TW410.0A0A1S3TW41_VIGRR; probable WRKY transcription factor 4 isoform X1
STRINGXP_007139560.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF154534100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-133WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]