PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v2938410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GRAS
Protein Properties Length: 465aa    MW: 51857.1 Da    PI: 6.4578
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v2938410.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS301.42.3e-92574622373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar..svselykalppsetsekn..sseelaalkl..fsevsP 89 
                      ++lL++cA+a++++d +laq++L+ l+++a pdgd++qRla+ f++AL ar a+  s++ l++++++ +++++    ++++++ +l  f++++P
  Lj1g3v2938410.1  57 EQLLVHCANAIETNDVTLAQQILWVLNNIAPPDGDSNQRLAHSFLRALTARAAKtgSCKMLVETVAVPPNNNNFtvDTHKFSVIELanFVDLTP 150
                      79***************************************************97677788888766666544343333444444489****** PP

             GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.....skeeleetgerLakfAeelgvpfe 177
                      +++f++ +aN aIlea+eg + +Hi+D+++++++Q p+L++a+asR  + pp +++T+ g + s         +  e+g +L +fA++ +v +e
  Lj1g3v2938410.1 151 WHRFGFTAANAAILEATEGYSVIHIVDLSLTHCMQIPTLIDAIASRHdGAPPVIKLTVPGCNYSReippvLDLTHDELGAKLVNFARSRNVILE 244
                      ***********************************************66688*****87776555678776777889***************** PP

             GRAS 178 fnvl.......vakrledleleeLrvkp.........gEalaVnlvlqlhrll................desvsles..erdevLklvkslsPk 237
                      f+v+        a       +e+Lrv++          Eal+Vn++++lh+++                ++     s   r+ +Lk++++l P+
  Lj1g3v2938410.1 245 FRVVsssytdgFAGL-----IEHLRVQRlihaaearaAEALVVNCHMMLHYIPeetlstsynaydsscaSS-----SmsLRSLFLKALRGLDPT 328
                      ***955533332333.....55555555555556777****************999999999985543333.....233577************ PP

             GRAS 238 vvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplse 331
                      +vv+v+++ad++s++++ r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+nv+a+eg +r+er e+   W++r+++a F+ + +se
  Lj1g3v2938410.1 329 IVVLVDEDADLTSSNLVCRLRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAD-ICWKIENVIAHEGVNRVERVERRTVWEQRMRNASFQGIGFSE 421
                      ***************************************************.****************************************** PP

             GRAS 332 kaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      + + ++k++l +++  g+ +++e++ +vl+Wk++++v++SaW
  Lj1g3v2938410.1 422 DSVVEVKAMLDEHA-AGWGLKKEDEHVVLTWKGHNVVFASAW 462
                      **************.999************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.2930444IPR005202Transcription factor GRAS
PfamPF035147.9E-9057462IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MMQFTPPLPP LHQITPIFSN PSSMNKNNQI PRNTRPWPAG FPTSKSLSSF GDANCMEQLL  60
VHCANAIETN DVTLAQQILW VLNNIAPPDG DSNQRLAHSF LRALTARAAK TGSCKMLVET  120
VAVPPNNNNF TVDTHKFSVI ELANFVDLTP WHRFGFTAAN AAILEATEGY SVIHIVDLSL  180
THCMQIPTLI DAIASRHDGA PPVIKLTVPG CNYSREIPPV LDLTHDELGA KLVNFARSRN  240
VILEFRVVSS SYTDGFAGLI EHLRVQRLIH AAEARAAEAL VVNCHMMLHY IPEETLSTSY  300
NAYDSSCASS SMSLRSLFLK ALRGLDPTIV VLVDEDADLT SSNLVCRLRS AFNYLWIPYD  360
TVDTFLPRGS KQRQWYEADI CWKIENVIAH EGVNRVERVE RRTVWEQRMR NASFQGIGFS  420
EDSVVEVKAM LDEHAAGWGL KKEDEHVVLT WKGHNVVFAS AWLPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B4e-493846466474Protein SHORT-ROOT
5b3h_B2e-493846412420Protein SHORT-ROOT
5b3h_E2e-493846412420Protein SHORT-ROOT
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v2938410.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0060850.0AP006085.1 Lotus japonicus genomic DNA, chromosome 4, clone: LjT28L24, TM0128, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020228765.10.0scarecrow-like protein 32
SwissprotQ9SN221e-176SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A445G7K20.0A0A445G7K2_GLYSO; Scarecrow-like protein 32
STRINGGLYMA05G22140.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-163GRAS family protein