PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v2823880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 437aa    MW: 48520.4 Da    PI: 6.513
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v2823880.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.84.6e-33103160260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      +DgynWrKYGqK+vkgse+prsYY+Ct+++C+vkkkvers+ d++++ei+Y+g Hnh+k
  Lj1g3v2823880.1 103 EDGYNWRKYGQKQVKGSEYPRSYYKCTQPNCQVKKKVERSH-DGQITEIIYKGAHNHPK 160
                      7****************************************.***************85 PP

2WRKY104.55.7e-33309367159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vkg+++prsYY+CtsagCpv+k+ver++++ k+v++tYeg+Hnhe
  Lj1g3v2823880.1 309 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCPVRKHVERASHNLKYVITTYEGKHNHE 367
                      59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.4E-2988161IPR003657WRKY domain
PROSITE profilePS5081124.22597161IPR003657WRKY domain
SuperFamilySSF1182901.44E-25100161IPR003657WRKY domain
SMARTSM007741.9E-36102160IPR003657WRKY domain
PfamPF031061.5E-25103159IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.9E-36294369IPR003657WRKY domain
SuperFamilySSF1182901.09E-28302369IPR003657WRKY domain
PROSITE profilePS5081137.769304369IPR003657WRKY domain
SMARTSM007741.1E-37309368IPR003657WRKY domain
PfamPF031061.7E-25310367IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MMKEGNRGSQ LLVQVQPPLN FPFPEDFPKG YPAINGEVHS YNDVSMVNDN ANHVEMSVSR  60
SEEASDESTL PENAIDGEDT GQQLVVEEQK ETSHATGVVR TSEDGYNWRK YGQKQVKGSE  120
YPRSYYKCTQ PNCQVKKKVE RSHDGQITEI IYKGAHNHPK PHSSRRTSAL SNDEISEIAE  180
AGETCVKVDC DSVWGNIHSG MRDTKHRLAW KADGQERTSS ASAMTELADP ISTKRAKPES  240
EDTPEFSSTH ASHGGDADGA TQAVMSLEDD AESESKRRKK ESYTVEAMPP RAVREPRVVV  300
QIESEIDILD DGYRWRKYGQ KVVKGNPNPR SYYKCTSAGC PVRKHVERAS HNLKYVITTY  360
EGKHNHEVPT ARNNNQISSN DGGGANGQAG LTLHGSASIP KPEPHQTLAP HFDRKPDFSN  420
EFLRQGLIGS LGNDLKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-3392369277Probable WRKY transcription factor 4
2lex_A3e-3392369277Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Low expression in senescent leaves (PubMed:11722756). Expressed in both the unfertilized egg cell and the pollen tube (PubMed:21316593). {ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:21316593}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Regulates WOX8 and WOX9 expression and basal cell division patterns during early embryogenesis. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Required to repolarize the zygote from a transient symmetric state. {ECO:0000269|PubMed:21316593}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v2823880.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007139725.10.0hypothetical protein PHAVU_008G054100g
SwissprotQ9FG771e-83WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLA0A371FKQ90.0A0A371FKQ9_MUCPR; Putative WRKY transcription factor 2 (Fragment)
STRINGXP_007139725.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83493445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.16e-78WRKY family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Ueda M, et al.
    Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote.
    Genes Dev., 2017. 31(6): p. 617-627
    [PMID:28404632]
  4. Lei R, et al.
    Arabidopsis WRKY2 and WRKY34 transcription factors interact with VQ20 protein to modulate pollen development and function.
    Plant J., 2017. 91(6): p. 962-976
    [PMID:28635025]